Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprG-sprF/- |
| Location | 2421544..2421807 | Replicon | chromosome |
| Accession | NZ_CP127024 | ||
| Organism | Staphylococcus aureus strain CC239-MRSA-III(var.) isolate Trinidad&Tobago_2020-048_8421A | ||
Toxin (Protein)
| Gene name | SprG3 | Uniprot ID | Q2FWA7 |
| Locus tag | QQO08_RS12285 | Protein ID | WP_001802298.1 |
| Coordinates | 2421703..2421807 (-) | Length | 35 a.a. |
Antitoxin (RNA)
| Gene name | SprF4 | ||
| Locus tag | - | ||
| Coordinates | 2421544..2421708 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QQO08_RS12260 (QQO08_12260) | 2417727..2418392 | - | 666 | WP_001024094.1 | SDR family oxidoreductase | - |
| QQO08_RS12265 (QQO08_12265) | 2418544..2418864 | + | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
| QQO08_RS12270 (QQO08_12270) | 2418866..2419846 | + | 981 | WP_000019744.1 | CDF family zinc efflux transporter CzrB | - |
| QQO08_RS12275 (QQO08_12275) | 2420112..2421203 | + | 1092 | WP_000495671.1 | lytic regulatory protein | - |
| - | 2421544..2421708 | + | 165 | - | - | Antitoxin |
| QQO08_RS12285 (QQO08_12285) | 2421703..2421807 | - | 105 | WP_001802298.1 | hypothetical protein | Toxin |
| QQO08_RS12290 (QQO08_12290) | 2421968..2422451 | - | 484 | Protein_2386 | recombinase family protein | - |
| QQO08_RS12295 (QQO08_12295) | 2422494..2423630 | - | 1137 | WP_000115564.1 | SAP domain-containing protein | - |
| QQO08_RS12300 (QQO08_12300) | 2423919..2424011 | + | 93 | WP_001790138.1 | hypothetical protein | - |
| QQO08_RS12305 (QQO08_12305) | 2424716..2425573 | - | 858 | WP_000370924.1 | HAD family hydrolase | - |
| QQO08_RS12310 (QQO08_12310) | 2425641..2426423 | - | 783 | WP_000908176.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T283541 WP_001802298.1 NZ_CP127024:c2421807-2421703 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
Antitoxin
Download Length: 165 bp
>AT283541 NZ_CP127024:2421544-2421708 [Staphylococcus aureus]
GTAGTAAGTAGAAGCAAAAGATGAAAATCATTAACTCTTGAAACACAAAAAGGGCAACACTCGGAAACATGTTACCCTAA
TGAGCCCGTTAAAAAGACGGTGACCTTATATTTTATTTAAAAATAGCCTTCAAAAATGCCGGTCAAAGCGAATAGAAGGT
TATTT
GTAGTAAGTAGAAGCAAAAGATGAAAATCATTAACTCTTGAAACACAAAAAGGGCAACACTCGGAAACATGTTACCCTAA
TGAGCCCGTTAAAAAGACGGTGACCTTATATTTTATTTAAAAATAGCCTTCAAAAATGCCGGTCAAAGCGAATAGAAGGT
TATTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|