Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 2001604..2001786 | Replicon | chromosome |
| Accession | NZ_CP127024 | ||
| Organism | Staphylococcus aureus strain CC239-MRSA-III(var.) isolate Trinidad&Tobago_2020-048_8421A | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | QQO08_RS09875 | Protein ID | WP_001801861.1 |
| Coordinates | 2001604..2001699 (+) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 2001727..2001786 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QQO08_RS09835 (QQO08_09835) | 1997264..1997890 | + | 627 | WP_000669046.1 | hypothetical protein | - |
| QQO08_RS09840 (QQO08_09840) | 1997931..1998275 | + | 345 | WP_000627551.1 | DUF3969 family protein | - |
| QQO08_RS09845 (QQO08_09845) | 1998373..1998924 | + | 552 | WP_000414205.1 | hypothetical protein | - |
| QQO08_RS09850 (QQO08_09850) | 1999142..1999783 | - | 642 | WP_000494956.1 | ImmA/IrrE family metallo-endopeptidase | - |
| QQO08_RS09855 (QQO08_09855) | 1999897..2000082 | - | 186 | WP_000809857.1 | hypothetical protein | - |
| QQO08_RS09860 (QQO08_09860) | 2000084..2000260 | - | 177 | WP_000375476.1 | hypothetical protein | - |
| QQO08_RS09865 (QQO08_09865) | 2000271..2000654 | - | 384 | WP_000070811.1 | hypothetical protein | - |
| QQO08_RS09870 (QQO08_09870) | 2001258..2001401 | - | 144 | WP_001549059.1 | transposase | - |
| QQO08_RS09875 (QQO08_09875) | 2001604..2001699 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| - | 2001727..2001786 | - | 60 | - | - | Antitoxin |
| QQO08_RS09880 (QQO08_09880) | 2001822..2001923 | + | 102 | WP_001791893.1 | hypothetical protein | - |
| QQO08_RS09885 (QQO08_09885) | 2001901..2002077 | - | 177 | Protein_1950 | transposase | - |
| QQO08_RS09890 (QQO08_09890) | 2002271..2002648 | - | 378 | WP_001037045.1 | DUF1433 domain-containing protein | - |
| QQO08_RS09895 (QQO08_09895) | 2003169..2004437 | - | 1269 | Protein_1952 | ATP-binding protein | - |
| QQO08_RS09900 (QQO08_09900) | 2004489..2005660 | - | 1172 | Protein_1953 | IS256-like element IS256 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 2004794..2005660 | 866 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T283535 WP_001801861.1 NZ_CP127024:2001604-2001699 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
Antitoxin
Download Length: 60 bp
>AT283535 NZ_CP127024:c2001786-2001727 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
