Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprG-sprF/- |
| Location | 2418744..2419023 | Replicon | chromosome |
| Accession | NZ_CP127021 | ||
| Organism | Staphylococcus aureus strain CC239-MRSA-III(var.) isolate Trinidad&Tobago_2020-021_7037M | ||
Toxin (Protein)
| Gene name | SprG3 | Uniprot ID | Q2FWA7 |
| Locus tag | QQO10_RS12290 | Protein ID | WP_001802298.1 |
| Coordinates | 2418919..2419023 (-) | Length | 35 a.a. |
Antitoxin (RNA)
| Gene name | SprF3 | ||
| Locus tag | - | ||
| Coordinates | 2418744..2418923 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QQO10_RS12265 (QQO10_12265) | 2414943..2415608 | - | 666 | WP_001024094.1 | SDR family oxidoreductase | - |
| QQO10_RS12270 (QQO10_12270) | 2415760..2416080 | + | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
| QQO10_RS12275 (QQO10_12275) | 2416082..2417062 | + | 981 | WP_000019744.1 | CDF family zinc efflux transporter CzrB | - |
| QQO10_RS12280 (QQO10_12280) | 2417328..2418419 | + | 1092 | WP_000495671.1 | lytic regulatory protein | - |
| - | 2418744..2418923 | + | 180 | - | - | Antitoxin |
| QQO10_RS12290 (QQO10_12290) | 2418919..2419023 | - | 105 | WP_001802298.1 | hypothetical protein | Toxin |
| QQO10_RS12295 (QQO10_12295) | 2419184..2419667 | - | 484 | Protein_2387 | recombinase family protein | - |
| QQO10_RS12300 (QQO10_12300) | 2419710..2420846 | - | 1137 | WP_000115564.1 | SAP domain-containing protein | - |
| QQO10_RS12305 (QQO10_12305) | 2421135..2421227 | + | 93 | WP_001790138.1 | hypothetical protein | - |
| QQO10_RS12310 (QQO10_12310) | 2421932..2422789 | - | 858 | WP_000370924.1 | HAD family hydrolase | - |
| QQO10_RS12315 (QQO10_12315) | 2422857..2423639 | - | 783 | WP_000908176.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T283525 WP_001802298.1 NZ_CP127021:c2419023-2418919 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
Antitoxin
Download Length: 180 bp
>AT283525 NZ_CP127021:2418744-2418923 [Staphylococcus aureus]
GTGTTAAAATATATTTGTAGTAAGTAGAAGCAAAAGATGAAAATCATTAACTCTTGAAACACAAAAAGGGCAACACTCGG
AAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGACCTTATATTTTATTTAAAAATAGCCTTCAAAAATGCCGGTC
AAAGCGAATAGAAGGTTATT
GTGTTAAAATATATTTGTAGTAAGTAGAAGCAAAAGATGAAAATCATTAACTCTTGAAACACAAAAAGGGCAACACTCGG
AAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGACCTTATATTTTATTTAAAAATAGCCTTCAAAAATGCCGGTC
AAAGCGAATAGAAGGTTATT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|