Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) sprA1-sprA1AS/-
Location 2003547..2003729 Replicon chromosome
Accession NZ_CP127019
Organism Staphylococcus aureus strain CC239-MRSA-III(var.) isolate Trinidad&Tobago_2020-009_371M

Toxin (Protein)


Gene name sprA1 Uniprot ID -
Locus tag QQO11_RS09895 Protein ID WP_001801861.1
Coordinates 2003547..2003642 (+) Length 32 a.a.

Antitoxin (RNA)


Gene name sprA1AS
Locus tag -
Coordinates 2003670..2003729 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QQO11_RS09855 1999207..1999833 + 627 WP_000669046.1 hypothetical protein -
QQO11_RS09860 1999874..2000218 + 345 WP_000627551.1 DUF3969 family protein -
QQO11_RS09865 2000316..2000867 + 552 WP_000414205.1 hypothetical protein -
QQO11_RS09870 2001085..2001726 - 642 WP_000494956.1 ImmA/IrrE family metallo-endopeptidase -
QQO11_RS09875 2001840..2002025 - 186 WP_000809857.1 hypothetical protein -
QQO11_RS09880 2002027..2002203 - 177 WP_000375476.1 hypothetical protein -
QQO11_RS09885 2002214..2002597 - 384 WP_000070811.1 hypothetical protein -
QQO11_RS09890 2003201..2003344 - 144 WP_001549059.1 transposase -
QQO11_RS09895 2003547..2003642 + 96 WP_001801861.1 type I toxin-antitoxin system Fst family toxin PepA1 Toxin
- 2003670..2003729 - 60 - - Antitoxin
QQO11_RS09900 2003765..2003866 + 102 WP_001791893.1 hypothetical protein -
QQO11_RS09905 2003844..2004020 - 177 Protein_1954 transposase -
QQO11_RS09910 2004214..2004591 - 378 WP_001037045.1 DUF1433 domain-containing protein -
QQO11_RS09915 2005112..2006380 - 1269 Protein_1956 ATP-binding protein -
QQO11_RS09920 2006432..2007603 - 1172 Protein_1957 IS256-like element IS256 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- flank IS/Tn - - 2006737..2007603 866


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.



Sequences

Toxin        


Download         Length: 32 a.a.        Molecular weight: 3554.32 Da        Isoelectric Point: 10.4449

>T283500 WP_001801861.1 NZ_CP127019:2003547-2003642 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK

Download         Length: 96 bp

Antitoxin


Download         Length: 60 bp

>AT283500 NZ_CP127019:c2003729-2003670 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Download structure file

References