Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 1694307..1694923 | Replicon | chromosome |
| Accession | NZ_CP126994 | ||
| Organism | Acidisoma sp. PAMC 29798 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | QP803_RS08110 | Protein ID | WP_284947264.1 |
| Coordinates | 1694307..1694603 (+) | Length | 99 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | QP803_RS08115 | Protein ID | WP_284947265.1 |
| Coordinates | 1694615..1694923 (+) | Length | 103 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QP803_RS08100 | 1690543..1691262 | - | 720 | WP_284947262.1 | hypothetical protein | - |
| QP803_RS08105 | 1691919..1694039 | + | 2121 | WP_284947263.1 | DUF3363 domain-containing protein | - |
| QP803_RS08110 | 1694307..1694603 | + | 297 | WP_284947264.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| QP803_RS08115 | 1694615..1694923 | + | 309 | WP_284947265.1 | HigA family addiction module antitoxin | Antitoxin |
| QP803_RS08120 | 1695053..1695301 | + | 249 | WP_284947266.1 | hypothetical protein | - |
| QP803_RS08125 | 1695323..1696396 | + | 1074 | Protein_1608 | recombinase family protein | - |
| QP803_RS08130 | 1696538..1696783 | - | 246 | WP_284947267.1 | hypothetical protein | - |
| QP803_RS08140 | 1697072..1697674 | - | 603 | WP_284947268.1 | DUF1684 domain-containing protein | - |
| QP803_RS08145 | 1697741..1699165 | - | 1425 | WP_284947269.1 | sensor domain-containing diguanylate cyclase | - |
| QP803_RS08150 | 1699316..1699777 | - | 462 | WP_284947270.1 | CreA family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11714.15 Da Isoelectric Point: 6.0778
>T283475 WP_284947264.1 NZ_CP126994:1694307-1694603 [Acidisoma sp. PAMC 29798]
MIVGFRDEWLHAFFVDDVRSRNIPPDLEARLFRKLQMIDDATTDQDLRVPPSNHFEKLRGNLAEFHSIRVNQQWRLIFRW
DGGRGEAADIYLDDHSYR
MIVGFRDEWLHAFFVDDVRSRNIPPDLEARLFRKLQMIDDATTDQDLRVPPSNHFEKLRGNLAEFHSIRVNQQWRLIFRW
DGGRGEAADIYLDDHSYR
Download Length: 297 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|