Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 63745..64338 | Replicon | chromosome |
| Accession | NZ_CP126992 | ||
| Organism | Pseudomonas syringae pv. antirrhini str. 126 | ||
Toxin (Protein)
| Gene name | graT | Uniprot ID | - |
| Locus tag | QQF68_RS00320 | Protein ID | WP_081025557.1 |
| Coordinates | 63745..64023 (+) | Length | 93 a.a. |
Antitoxin (Protein)
| Gene name | graA | Uniprot ID | Q88B19 |
| Locus tag | QQF68_RS00325 | Protein ID | WP_005739893.1 |
| Coordinates | 64033..64338 (+) | Length | 102 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QQF68_RS00300 (QQF68_00300) | 59007..60245 | - | 1239 | WP_057419370.1 | diaminopimelate decarboxylase | - |
| QQF68_RS00305 (QQF68_00305) | 60247..61122 | - | 876 | WP_011103032.1 | DMT family transporter | - |
| QQF68_RS00310 (QQF68_00310) | 61122..62405 | - | 1284 | WP_057419369.1 | lysine N(6)-hydroxylase/L-ornithine N(5)-oxygenase family protein | - |
| QQF68_RS00315 (QQF68_00315) | 62560..63495 | + | 936 | WP_005739904.1 | LysR family transcriptional regulator | - |
| QQF68_RS00320 (QQF68_00320) | 63745..64023 | + | 279 | WP_081025557.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| QQF68_RS00325 (QQF68_00325) | 64033..64338 | + | 306 | WP_005739893.1 | HigA family addiction module antitoxin | Antitoxin |
| QQF68_RS00330 (QQF68_00330) | 64372..64653 | - | 282 | WP_007246531.1 | accessory factor UbiK family protein | - |
| QQF68_RS00335 (QQF68_00335) | 65073..65411 | + | 339 | WP_002555808.1 | P-II family nitrogen regulator | - |
| QQF68_RS00340 (QQF68_00340) | 65447..66784 | + | 1338 | WP_005739890.1 | ammonium transporter | - |
| QQF68_RS00345 (QQF68_00345) | 67027..67452 | + | 426 | WP_005768513.1 | secondary thiamine-phosphate synthase enzyme YjbQ | - |
| QQF68_RS00350 (QQF68_00350) | 67551..67883 | + | 333 | WP_007246533.1 | transcriptional regulator SutA | - |
| QQF68_RS00355 (QQF68_00355) | 67958..68650 | - | 693 | WP_057419367.1 | HAD family hydrolase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10461.09 Da Isoelectric Point: 9.1475
>T283465 WP_081025557.1 NZ_CP126992:63745-64023 [Pseudomonas syringae pv. antirrhini str. 126]
MIVSFKCVNTRYLFLQGKTRLWPSIKSVAERKLAMLDAATSILDLRSPPGNRLEALDGSRSGQYSVRINAQFRICFVWSI
NGPEDVEIVDYH
MIVSFKCVNTRYLFLQGKTRLWPSIKSVAERKLAMLDAATSILDLRSPPGNRLEALDGSRSGQYSVRINAQFRICFVWSI
NGPEDVEIVDYH
Download Length: 279 bp
Antitoxin
Download Length: 102 a.a. Molecular weight: 11158.01 Da Isoelectric Point: 7.7509
>AT283465 WP_005739893.1 NZ_CP126992:64033-64338 [Pseudomonas syringae pv. antirrhini str. 126]
MNKNGMRPVHPGEVLKEEYLEPMGLTAAALARALKVSTPTVNDIVLQRRGVSADVALRLAVCLETSPEFWLNLQLAYDLR
KAETEKGAQIREQVKCLAHCA
MNKNGMRPVHPGEVLKEEYLEPMGLTAAALARALKVSTPTVNDIVLQRRGVSADVALRLAVCLETSPEFWLNLQLAYDLR
KAETEKGAQIREQVKCLAHCA
Download Length: 306 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|