Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 357105..357751 | Replicon | chromosome |
Accession | NZ_CP126987 | ||
Organism | Klebsiella pneumoniae subsp. pneumoniae strain T3 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A4S7KZ03 |
Locus tag | QP573_RS01640 | Protein ID | WP_032433636.1 |
Coordinates | 357105..357452 (+) | Length | 116 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | A0A4S7L580 |
Locus tag | QP573_RS01645 | Protein ID | WP_019725405.1 |
Coordinates | 357452..357751 (+) | Length | 100 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QP573_RS01630 (353031) | 353031..354464 | + | 1434 | WP_032433640.1 | glycogen synthase GlgA | - |
QP573_RS01635 (354482) | 354482..356929 | + | 2448 | WP_032433638.1 | glycogen phosphorylase | - |
QP573_RS01640 (357105) | 357105..357452 | + | 348 | WP_032433636.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QP573_RS01645 (357452) | 357452..357751 | + | 300 | WP_019725405.1 | XRE family transcriptional regulator | Antitoxin |
QP573_RS01650 (357814) | 357814..359322 | - | 1509 | WP_029602548.1 | glycerol-3-phosphate dehydrogenase | - |
QP573_RS01655 (359527) | 359527..359856 | + | 330 | WP_002920552.1 | thiosulfate sulfurtransferase GlpE | - |
QP573_RS01660 (359907) | 359907..360737 | + | 831 | WP_004151408.1 | rhomboid family intramembrane serine protease GlpG | - |
QP573_RS01665 (360787) | 360787..361545 | + | 759 | WP_002920548.1 | DeoR/GlpR family transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 13500.51 Da Isoelectric Point: 6.2327
>T283451 WP_032433636.1 NZ_CP126987:357105-357452 [Klebsiella pneumoniae subsp. pneumoniae]
MWDVETTDTFDAWFELQSRALKEDMLATMLILSEFAPQLGRPYVDTVKDSTFQNMKELRVQHHGLPIRAFFAFDPLRKAI
VLCAGNKDGINEKRFYKEMITLADREFSQHLTKER
MWDVETTDTFDAWFELQSRALKEDMLATMLILSEFAPQLGRPYVDTVKDSTFQNMKELRVQHHGLPIRAFFAFDPLRKAI
VLCAGNKDGINEKRFYKEMITLADREFSQHLTKER
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A4S7KZ03 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A4S7L580 |