Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 330918..331504 Replicon chromosome
Accession NZ_CP126987
Organism Klebsiella pneumoniae subsp. pneumoniae strain T3

Toxin (Protein)


Gene name doc Uniprot ID W8VD46
Locus tag QP573_RS01530 Protein ID WP_002920800.1
Coordinates 331136..331504 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID W9B1V1
Locus tag QP573_RS01525 Protein ID WP_004174006.1
Coordinates 330918..331139 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QP573_RS01505 (327075) 327075..328001 + 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
QP573_RS01510 (327998) 327998..329275 + 1278 WP_004174005.1 branched chain amino acid ABC transporter permease LivM -
QP573_RS01515 (329272) 329272..330039 + 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
QP573_RS01520 (330041) 330041..330754 + 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
QP573_RS01525 (330918) 330918..331139 + 222 WP_004174006.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
QP573_RS01530 (331136) 331136..331504 + 369 WP_002920800.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
QP573_RS01535 (331777) 331777..333093 + 1317 WP_004174008.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
QP573_RS01540 (333200) 333200..334087 + 888 WP_002920792.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
QP573_RS01545 (334084) 334084..334929 + 846 WP_004145129.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
QP573_RS01550 (334931) 334931..336001 + 1071 WP_032433652.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 327998..336738 8740


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(13-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13552.92 Da        Isoelectric Point: 8.6410

>T283450 WP_002920800.1 NZ_CP126987:331136-331504 [Klebsiella pneumoniae subsp. pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8151.15 Da        Isoelectric Point: 4.7769

>AT283450 WP_004174006.1 NZ_CP126987:330918-331139 [Klebsiella pneumoniae subsp. pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQAARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GUD1

Antitoxin

Source ID Structure
AlphaFold DB A0A5E5YJY7

References