Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 9006722..9007310 | Replicon | chromosome |
Accession | NZ_CP126980 | ||
Organism | Actinoplanes sp. NRRL 3884 |
Toxin (Protein)
Gene name | graT | Uniprot ID | - |
Locus tag | Actob_RS40115 | Protein ID | WP_284917191.1 |
Coordinates | 9007029..9007310 (-) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | Actob_RS40110 | Protein ID | WP_284917190.1 |
Coordinates | 9006722..9007015 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
Actob_RS40080 (ACTOB_008016) | 9002067..9002813 | - | 747 | WP_284917184.1 | peptidase E | - |
Actob_RS40085 (ACTOB_008017) | 9002810..9003643 | - | 834 | WP_284917185.1 | DNA polymerase subunit beta | - |
Actob_RS40090 (ACTOB_008018) | 9003675..9004499 | - | 825 | WP_284917186.1 | G5 domain-containing protein | - |
Actob_RS40095 (ACTOB_008019) | 9004709..9005173 | + | 465 | WP_284917187.1 | MarR family transcriptional regulator | - |
Actob_RS40100 (ACTOB_008020) | 9005181..9005777 | - | 597 | WP_284917188.1 | phosphoesterase PA-phosphatase | - |
Actob_RS40105 (ACTOB_008021) | 9005972..9006553 | + | 582 | WP_284917189.1 | Uma2 family endonuclease | - |
Actob_RS40110 (ACTOB_008022) | 9006722..9007015 | - | 294 | WP_284917190.1 | HigA family addiction module antitoxin | Antitoxin |
Actob_RS40115 (ACTOB_008023) | 9007029..9007310 | - | 282 | WP_284917191.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
Actob_RS40120 (ACTOB_008024) | 9007464..9008549 | - | 1086 | WP_284917192.1 | redox-regulated ATPase YchF | - |
Actob_RS40125 (ACTOB_008025) | 9008572..9009357 | - | 786 | WP_284917193.1 | alpha/beta hydrolase | - |
Actob_RS40130 (ACTOB_008026) | 9009487..9010986 | + | 1500 | WP_284917194.1 | AlkA N-terminal domain-containing protein | - |
Actob_RS40135 (ACTOB_008027) | 9011114..9011611 | + | 498 | WP_284917195.1 | methylated-DNA--[protein]-cysteine S-methyltransferase | - |
Actob_RS40140 (ACTOB_008028) | 9011554..9012276 | - | 723 | WP_284917196.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10835.33 Da Isoelectric Point: 8.0772
>T283447 WP_284917191.1 NZ_CP126980:c9007310-9007029 [Actinoplanes sp. NRRL 3884]
VIRSFGNRETERLWQREHVRSLDTRVLRTALRKLALLDAAMALADLRVPPGNRLEALSGDRKGQHSIRINDQWRICFVWT
ETGPEDVEIVDYH
VIRSFGNRETERLWQREHVRSLDTRVLRTALRKLALLDAAMALADLRVPPGNRLEALSGDRKGQHSIRINDQWRICFVWT
ETGPEDVEIVDYH
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|