Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 8993664..8994370 | Replicon | chromosome |
| Accession | NZ_CP126980 | ||
| Organism | Actinoplanes sp. NRRL 3884 | ||
Toxin (Protein)
| Gene name | HigB2 | Uniprot ID | - |
| Locus tag | Actob_RS40025 | Protein ID | WP_284917174.1 |
| Coordinates | 8993664..8994029 (+) | Length | 122 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | Actob_RS40030 | Protein ID | WP_284922489.1 |
| Coordinates | 8994032..8994370 (+) | Length | 113 a.a. |
Genomic Context
Location: 8993664..8994029 (366 bp)
Type: Toxin
Protein ID: WP_284917174.1
Type: Toxin
Protein ID: WP_284917174.1
Location: 8994032..8994370 (339 bp)
Type: Antitoxin
Protein ID: WP_284922489.1
Type: Antitoxin
Protein ID: WP_284922489.1
Location: 8997667..8999220 (1554 bp)
Type: Others
Protein ID: WP_284917178.1
Type: Others
Protein ID: WP_284917178.1
Location: 8990948..8993542 (2595 bp)
Type: Others
Protein ID: WP_284917173.1
Type: Others
Protein ID: WP_284917173.1
Location: 8994444..8995532 (1089 bp)
Type: Others
Protein ID: WP_284917175.1
Type: Others
Protein ID: WP_284917175.1
Location: 8995529..8996938 (1410 bp)
Type: Others
Protein ID: WP_284917176.1
Type: Others
Protein ID: WP_284917176.1
Location: 8996935..8997564 (630 bp)
Type: Others
Protein ID: WP_284917177.1
Type: Others
Protein ID: WP_284917177.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| Actob_RS40020 (ACTOB_008004) | 8990948..8993542 | - | 2595 | WP_284917173.1 | LuxR C-terminal-related transcriptional regulator | - |
| Actob_RS40025 (ACTOB_008005) | 8993664..8994029 | + | 366 | WP_284917174.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| Actob_RS40030 (ACTOB_008006) | 8994032..8994370 | + | 339 | WP_284922489.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| Actob_RS40035 (ACTOB_008007) | 8994444..8995532 | - | 1089 | WP_284917175.1 | alcohol dehydrogenase catalytic domain-containing protein | - |
| Actob_RS40040 (ACTOB_008008) | 8995529..8996938 | - | 1410 | WP_284917176.1 | aldehyde dehydrogenase family protein | - |
| Actob_RS40045 (ACTOB_008009) | 8996935..8997564 | - | 630 | WP_284917177.1 | TetR/AcrR family transcriptional regulator | - |
| Actob_RS40050 (ACTOB_008010) | 8997667..8999220 | + | 1554 | WP_284917178.1 | long-chain fatty acid--CoA ligase | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| No matching records found | |||||||
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 122 a.a. Molecular weight: 13786.47 Da Isoelectric Point: 5.2233
>T283446 WP_284917174.1 NZ_CP126980:8993664-8994029 [Actinoplanes sp. NRRL 3884]
VKEWEIFATDEFYAWADTLDRASLRHLVQAIDQLAEVGPGLGRPLVDHIEGSRVHNMKELRPGSSGRSEIRALFVFDPWR
STILLIGGDKSGNWSGWYRTAIPAAEELYARYLKDRQNEEA
VKEWEIFATDEFYAWADTLDRASLRHLVQAIDQLAEVGPGLGRPLVDHIEGSRVHNMKELRPGSSGRSEIRALFVFDPWR
STILLIGGDKSGNWSGWYRTAIPAAEELYARYLKDRQNEEA
Download Length: 366 bp
Antitoxin
Download Length: 113 a.a. Molecular weight: 12267.73 Da Isoelectric Point: 7.2007
>AT283446 WP_284922489.1 NZ_CP126980:8994032-8994370 [Actinoplanes sp. NRRL 3884]
VPGYHKWSDIRAEFVEKAGGEEAIAEARRQSQAYVNGYRLAERRKSIGLTQAEVAERMGVTKGRVSQIERGEVATVDAIA
RYVHALGGYLQISAVFGDDQYILRGTDPQAAA
VPGYHKWSDIRAEFVEKAGGEEAIAEARRQSQAYVNGYRLAERRKSIGLTQAEVAERMGVTKGRVSQIERGEVATVDAIA
RYVHALGGYLQISAVFGDDQYILRGTDPQAAA
Download Length: 339 bp