Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 188835..189495 | Replicon | chromosome |
Accession | NZ_CP126978 | ||
Organism | Gallibacterium anatis strain YJ922 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A0A3A103 |
Locus tag | QP019_RS01160 | Protein ID | WP_052124504.1 |
Coordinates | 189136..189495 (-) | Length | 120 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | A0A0A2ZWF9 |
Locus tag | QP019_RS01155 | Protein ID | WP_039163779.1 |
Coordinates | 188835..189134 (-) | Length | 100 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QP019_RS01130 (QP019_01130) | 184103..185176 | + | 1074 | WP_285096430.1 | DUF3383 family protein | - |
QP019_RS01135 (QP019_01135) | 185228..185653 | + | 426 | WP_264256125.1 | DUF3277 family protein | - |
QP019_RS01140 (QP019_01140) | 185653..186138 | + | 486 | WP_285096431.1 | hypothetical protein | - |
QP019_RS01145 (QP019_01145) | 186174..186326 | + | 153 | WP_017805951.1 | hypothetical protein | - |
QP019_RS01150 (QP019_01150) | 186323..188797 | + | 2475 | WP_285096432.1 | tape measure protein | - |
QP019_RS01155 (QP019_01155) | 188835..189134 | - | 300 | WP_039163779.1 | helix-turn-helix transcriptional regulator | Antitoxin |
QP019_RS01160 (QP019_01160) | 189136..189495 | - | 360 | WP_052124504.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QP019_RS01165 (QP019_01165) | 189561..190145 | + | 585 | WP_285096433.1 | hypothetical protein | - |
QP019_RS01170 (QP019_01170) | 190231..191376 | + | 1146 | WP_285096434.1 | type I restriction endonuclease | - |
QP019_RS01175 (QP019_01175) | 191460..191753 | + | 294 | Protein_227 | transposase | - |
QP019_RS01180 (QP019_01180) | 191771..192796 | + | 1026 | WP_285096435.1 | IS3 family transposase | - |
QP019_RS01185 (QP019_01185) | 192853..193626 | - | 774 | WP_285096436.1 | hypothetical protein | - |
QP019_RS01190 (QP019_01190) | 193692..194024 | + | 333 | WP_285096437.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 103046..245631 | 142585 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 120 a.a. Molecular weight: 13592.72 Da Isoelectric Point: 9.4530
>T283442 WP_052124504.1 NZ_CP126978:c189495-189136 [Gallibacterium anatis]
MAVNHQWNILFTDCFSKWLDQQDIPTKKSVAAALNLLKITGPELSRPYADTIKGSQYPNMKELRIQHQGKPLRAFFAFDP
LRQAIVLCAGDKSNDKQFYKRMIALADTEFAAYLANLEK
MAVNHQWNILFTDCFSKWLDQQDIPTKKSVAAALNLLKITGPELSRPYADTIKGSQYPNMKELRIQHQGKPLRAFFAFDP
LRQAIVLCAGDKSNDKQFYKRMIALADTEFAAYLANLEK
Download Length: 360 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0A3A103 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0A2ZWF9 |