Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 139892..140552 | Replicon | chromosome |
Accession | NZ_CP126978 | ||
Organism | Gallibacterium anatis strain YJ922 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A0A3A103 |
Locus tag | QP019_RS00785 | Protein ID | WP_052124504.1 |
Coordinates | 140193..140552 (-) | Length | 120 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | A0A0A2ZWF9 |
Locus tag | QP019_RS00780 | Protein ID | WP_039163779.1 |
Coordinates | 139892..140191 (-) | Length | 100 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QP019_RS00755 (QP019_00755) | 135160..136233 | + | 1074 | WP_285096430.1 | DUF3383 family protein | - |
QP019_RS00760 (QP019_00760) | 136285..136710 | + | 426 | WP_264256125.1 | DUF3277 family protein | - |
QP019_RS00765 (QP019_00765) | 136710..137195 | + | 486 | WP_285096431.1 | hypothetical protein | - |
QP019_RS00770 (QP019_00770) | 137231..137383 | + | 153 | WP_017805951.1 | hypothetical protein | - |
QP019_RS00775 (QP019_00775) | 137380..139854 | + | 2475 | WP_285096432.1 | tape measure protein | - |
QP019_RS00780 (QP019_00780) | 139892..140191 | - | 300 | WP_039163779.1 | helix-turn-helix transcriptional regulator | Antitoxin |
QP019_RS00785 (QP019_00785) | 140193..140552 | - | 360 | WP_052124504.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QP019_RS00790 (QP019_00790) | 140618..141202 | + | 585 | WP_285096433.1 | hypothetical protein | - |
QP019_RS00795 (QP019_00795) | 141288..142433 | + | 1146 | WP_285096434.1 | type I restriction endonuclease | - |
QP019_RS00800 (QP019_00800) | 142517..142810 | + | 294 | Protein_152 | transposase | - |
QP019_RS00805 (QP019_00805) | 142828..143853 | + | 1026 | WP_285096435.1 | IS3 family transposase | - |
QP019_RS00810 (QP019_00810) | 143910..144683 | - | 774 | WP_285096436.1 | hypothetical protein | - |
QP019_RS00815 (QP019_00815) | 144749..145081 | + | 333 | WP_285096437.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 103046..245631 | 142585 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 120 a.a. Molecular weight: 13592.72 Da Isoelectric Point: 9.4530
>T283440 WP_052124504.1 NZ_CP126978:c140552-140193 [Gallibacterium anatis]
MAVNHQWNILFTDCFSKWLDQQDIPTKKSVAAALNLLKITGPELSRPYADTIKGSQYPNMKELRIQHQGKPLRAFFAFDP
LRQAIVLCAGDKSNDKQFYKRMIALADTEFAAYLANLEK
MAVNHQWNILFTDCFSKWLDQQDIPTKKSVAAALNLLKITGPELSRPYADTIKGSQYPNMKELRIQHQGKPLRAFFAFDP
LRQAIVLCAGDKSNDKQFYKRMIALADTEFAAYLANLEK
Download Length: 360 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0A3A103 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0A2ZWF9 |