Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/RelE-HTH |
| Location | 685451..686094 | Replicon | chromosome |
| Accession | NZ_CP126977 | ||
| Organism | Gallibacterium anatis strain DFSO2 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | QP020_RS03285 | Protein ID | WP_285098898.1 |
| Coordinates | 685451..685795 (+) | Length | 115 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | QP020_RS03290 | Protein ID | WP_285098900.1 |
| Coordinates | 685798..686094 (+) | Length | 99 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QP020_RS03255 (QP020_03255) | 680659..680871 | + | 213 | WP_039149120.1 | TraR/DksA C4-type zinc finger protein | - |
| QP020_RS03260 (QP020_03260) | 680868..681359 | + | 492 | WP_013745052.1 | phage tail protein | - |
| QP020_RS03265 (QP020_03265) | 681347..681799 | + | 453 | WP_039149117.1 | phage virion morphogenesis protein | - |
| QP020_RS03270 (QP020_03270) | 681788..682168 | - | 381 | WP_285098894.1 | hypothetical protein | - |
| QP020_RS03275 (QP020_03275) | 682174..682455 | - | 282 | WP_285098895.1 | hypothetical protein | - |
| QP020_RS03280 (QP020_03280) | 682534..685377 | + | 2844 | WP_285098896.1 | phage tail tape measure protein | - |
| QP020_RS03285 (QP020_03285) | 685451..685795 | + | 345 | WP_285098898.1 | hypothetical protein | Toxin |
| QP020_RS03290 (QP020_03290) | 685798..686094 | + | 297 | WP_285098900.1 | NadS family protein | Antitoxin |
| QP020_RS03295 (QP020_03295) | 686215..686841 | + | 627 | WP_039146340.1 | phage baseplate assembly protein V | - |
| QP020_RS03300 (QP020_03300) | 686838..687170 | + | 333 | WP_285098901.1 | GPW/gp25 family protein | - |
| QP020_RS03305 (QP020_03305) | 687171..688082 | + | 912 | WP_285098902.1 | baseplate J/gp47 family protein | - |
| QP020_RS03310 (QP020_03310) | 688075..688614 | + | 540 | WP_285098904.1 | phage tail protein I | - |
| QP020_RS03315 (QP020_03315) | 688633..690483 | + | 1851 | WP_285098906.1 | phage tail protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 669654..713607 | 43953 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 115 a.a. Molecular weight: 13045.03 Da Isoelectric Point: 7.9955
>T283435 WP_285098898.1 NZ_CP126977:685451-685795 [Gallibacterium anatis]
MNTDKLITFIETPIFEEDRKALLSDEEYQAFQAYMLDNFHLGDFIQHTGGCQKIRWKLSGNNKGKSGGVRIIYYSLTAKG
KLYLLMMYPKSEKDNMNAAEKAILKSIVDQLKGD
MNTDKLITFIETPIFEEDRKALLSDEEYQAFQAYMLDNFHLGDFIQHTGGCQKIRWKLSGNNKGKSGGVRIIYYSLTAKG
KLYLLMMYPKSEKDNMNAAEKAILKSIVDQLKGD
Download Length: 345 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|