Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/RelE-HTH |
Location | 705510..706153 | Replicon | chromosome |
Accession | NZ_CP126975 | ||
Organism | Gallibacterium anatis strain BJF12 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | QP018_RS03430 | Protein ID | WP_285091016.1 |
Coordinates | 705510..705854 (+) | Length | 115 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | QP018_RS03435 | Protein ID | WP_039094358.1 |
Coordinates | 705857..706153 (+) | Length | 99 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QP018_RS03405 (QP018_03405) | 700711..701202 | + | 492 | WP_013745052.1 | phage tail protein | - |
QP018_RS03410 (QP018_03410) | 701190..701642 | + | 453 | WP_039090761.1 | phage virion morphogenesis protein | - |
QP018_RS03415 (QP018_03415) | 701631..702011 | - | 381 | WP_013745048.1 | hypothetical protein | - |
QP018_RS03420 (QP018_03420) | 702017..702298 | - | 282 | WP_013745047.1 | hypothetical protein | - |
QP018_RS03425 (QP018_03425) | 702377..705436 | + | 3060 | WP_285091015.1 | phage tail tape measure protein | - |
QP018_RS03430 (QP018_03430) | 705510..705854 | + | 345 | WP_285091016.1 | hypothetical protein | Toxin |
QP018_RS03435 (QP018_03435) | 705857..706153 | + | 297 | WP_039094358.1 | NadS family protein | Antitoxin |
QP018_RS03440 (QP018_03440) | 706275..706901 | + | 627 | WP_285091019.1 | phage baseplate assembly protein V | - |
QP018_RS03445 (QP018_03445) | 706903..707235 | + | 333 | WP_285091021.1 | GPW/gp25 family protein | - |
QP018_RS03450 (QP018_03450) | 707236..708147 | + | 912 | WP_285091022.1 | baseplate J/gp47 family protein | - |
QP018_RS03455 (QP018_03455) | 708140..708679 | + | 540 | WP_285091024.1 | phage tail protein I | - |
QP018_RS03460 (QP018_03460) | 708698..710548 | + | 1851 | WP_285091026.1 | phage tail protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 689614..724873 | 35259 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 115 a.a. Molecular weight: 13109.07 Da Isoelectric Point: 7.9955
>T283431 WP_285091016.1 NZ_CP126975:705510-705854 [Gallibacterium anatis]
MNTDKFITFIETPIFEEDRKALLSDEEYQAFQAYMLDNFHLGDFIQHTGGCQKIRWKLSGNNKGKSGGVRIIYYSLTAKG
KLYLLMMYPKSEKDNMNATEKAILKSIVDQLKGD
MNTDKFITFIETPIFEEDRKALLSDEEYQAFQAYMLDNFHLGDFIQHTGGCQKIRWKLSGNNKGKSGGVRIIYYSLTAKG
KLYLLMMYPKSEKDNMNATEKAILKSIVDQLKGD
Download Length: 345 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|