Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) yefM-yoeB (relBE)/YoeB-YefM
Location 1733392..1733911 Replicon chromosome
Accession NZ_CP126970
Organism Corynebacterium sp. LM112

Toxin (Protein)


Gene name yoeB Uniprot ID -
Locus tag QP029_RS08715 Protein ID WP_284873945.1
Coordinates 1733392..1733649 (-) Length 86 a.a.

Antitoxin (Protein)


Gene name yefM Uniprot ID -
Locus tag QP029_RS08720 Protein ID WP_284873946.1
Coordinates 1733654..1733911 (-) Length 86 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QP029_RS08680 (QP029_08680) 1729246..1729686 + 441 WP_284873941.1 YtoQ family protein -
QP029_RS08685 (QP029_08685) 1729963..1730244 + 282 WP_284873942.1 type II toxin-antitoxin system RelE/ParE family toxin -
QP029_RS08690 (QP029_08690) 1730255..1730551 + 297 WP_284873943.1 HigA family addiction module antitoxin -
QP029_RS08695 (QP029_08695) 1730669..1730974 + 306 WP_284873944.1 antibiotic biosynthesis monooxygenase family protein -
QP029_RS08700 (QP029_08700) 1730984..1731256 + 273 Protein_1694 2'-5' RNA ligase -
QP029_RS08705 (QP029_08705) 1731430..1732896 + 1467 WP_284876203.1 IS1634 family transposase -
QP029_RS08710 (QP029_08710) 1732926..1733363 + 438 Protein_1696 2'-5' RNA ligase -
QP029_RS08715 (QP029_08715) 1733392..1733649 - 258 WP_284873945.1 Txe/YoeB family addiction module toxin Toxin
QP029_RS08720 (QP029_08720) 1733654..1733911 - 258 WP_284873946.1 type II toxin-antitoxin system prevent-host-death family antitoxin Antitoxin
QP029_RS08725 (QP029_08725) 1734331..1736076 + 1746 WP_284873947.1 SulP family inorganic anion transporter -
QP029_RS08730 (QP029_08730) 1736082..1736399 - 318 WP_284873948.1 hypothetical protein -
QP029_RS08735 (QP029_08735) 1736548..1736991 - 444 WP_284873949.1 alternative ribosome rescue aminoacyl-tRNA hydrolase ArfB -
QP029_RS08740 (QP029_08740) 1737034..1737225 - 192 WP_284873950.1 CopG family transcriptional regulator -
QP029_RS08745 (QP029_08745) 1737351..1738388 - 1038 WP_284873951.1 tocopherol cyclase family protein -
QP029_RS08750 (QP029_08750) 1738514..1738765 + 252 WP_284876204.1 type II toxin-antitoxin system Phd/YefM family antitoxin -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin YoeB

(5-84)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-72)


Sequences

Toxin        


Download         Length: 86 a.a.        Molecular weight: 10295.79 Da        Isoelectric Point: 8.8754

>T283415 WP_284873945.1 NZ_CP126970:c1733649-1733392 [Corynebacterium sp. LM112]
MLLVWDENAWADYLWWQAQDRKTLKRINLLLKDIVRNGNEGIGKPEPLKHDFAGYWLRRITDEHRLVYKHTETEVRIAAC
RYHYG

Download         Length: 258 bp

Antitoxin


Download         Length: 86 a.a.        Molecular weight: 9579.71 Da        Isoelectric Point: 4.8307

>AT283415 WP_284873946.1 NZ_CP126970:c1733911-1733654 [Corynebacterium sp. LM112]
MRTMSYTESRANYAKVLDSVTDDREAVVITRAGHEPVVMVSLADYESLRETAYLMRSPANARRLFDAMERLEGGRGDAHD
VIETN

Download         Length: 258 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References