Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-VapI |
Location | 1729963..1730551 | Replicon | chromosome |
Accession | NZ_CP126970 | ||
Organism | Corynebacterium sp. LM112 |
Toxin (Protein)
Gene name | graT | Uniprot ID | - |
Locus tag | QP029_RS08685 | Protein ID | WP_284873942.1 |
Coordinates | 1729963..1730244 (+) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | QP029_RS08690 | Protein ID | WP_284873943.1 |
Coordinates | 1730255..1730551 (+) | Length | 99 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QP029_RS08670 (QP029_08670) | 1726869..1727597 | + | 729 | WP_284873939.1 | hypothetical protein | - |
QP029_RS08675 (QP029_08675) | 1727639..1729150 | + | 1512 | WP_284873940.1 | murein biosynthesis integral membrane protein MurJ | - |
QP029_RS08680 (QP029_08680) | 1729246..1729686 | + | 441 | WP_284873941.1 | YtoQ family protein | - |
QP029_RS08685 (QP029_08685) | 1729963..1730244 | + | 282 | WP_284873942.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QP029_RS08690 (QP029_08690) | 1730255..1730551 | + | 297 | WP_284873943.1 | HigA family addiction module antitoxin | Antitoxin |
QP029_RS08695 (QP029_08695) | 1730669..1730974 | + | 306 | WP_284873944.1 | antibiotic biosynthesis monooxygenase family protein | - |
QP029_RS08700 (QP029_08700) | 1730984..1731256 | + | 273 | Protein_1694 | 2'-5' RNA ligase | - |
QP029_RS08705 (QP029_08705) | 1731430..1732896 | + | 1467 | WP_284876203.1 | IS1634 family transposase | - |
QP029_RS08710 (QP029_08710) | 1732926..1733363 | + | 438 | Protein_1696 | 2'-5' RNA ligase | - |
QP029_RS08715 (QP029_08715) | 1733392..1733649 | - | 258 | WP_284873945.1 | Txe/YoeB family addiction module toxin | - |
QP029_RS08720 (QP029_08720) | 1733654..1733911 | - | 258 | WP_284873946.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10890.72 Da Isoelectric Point: 10.4396
>T283414 WP_284873942.1 NZ_CP126970:1729963-1730244 [Corynebacterium sp. LM112]
VIVSFADRDAERLFLRKRVRRLDPRVHRKALMKLLLLDAVHELGELRIPPGNRLEALKGDRIGQHSIRINDQWRICFVWT
VAGPSEVEIVDYH
VIVSFADRDAERLFLRKRVRRLDPRVHRKALMKLLLLDAVHELGELRIPPGNRLEALKGDRIGQHSIRINDQWRICFVWT
VAGPSEVEIVDYH
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|