Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yefM-yoeB (relBE)/Txe-RelB |
Location | 1708796..1709301 | Replicon | chromosome |
Accession | NZ_CP126964 | ||
Organism | Pseudoglutamicibacter albus strain UMB0715 |
Toxin (Protein)
Gene name | yoeB | Uniprot ID | - |
Locus tag | CJ193_RS07760 | Protein ID | WP_101630574.1 |
Coordinates | 1709035..1709301 (+) | Length | 89 a.a. |
Antitoxin (Protein)
Gene name | yefM | Uniprot ID | - |
Locus tag | CJ193_RS07755 | Protein ID | WP_101630575.1 |
Coordinates | 1708796..1709038 (+) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CJ193_RS07740 (CJ193_007740) | 1705931..1706911 | - | 981 | WP_143483924.1 | DUF1963 domain-containing protein | - |
CJ193_RS07745 (CJ193_007745) | 1706992..1707474 | + | 483 | WP_143483923.1 | hypothetical protein | - |
CJ193_RS07750 (CJ193_007750) | 1707554..1708585 | + | 1032 | WP_101630576.1 | LLM class flavin-dependent oxidoreductase | - |
CJ193_RS07755 (CJ193_007755) | 1708796..1709038 | + | 243 | WP_101630575.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
CJ193_RS07760 (CJ193_007760) | 1709035..1709301 | + | 267 | WP_101630574.1 | Txe/YoeB family addiction module toxin | Toxin |
CJ193_RS07765 (CJ193_007765) | 1709552..1711471 | + | 1920 | WP_101630625.1 | cation-translocating P-type ATPase | - |
CJ193_RS07770 (CJ193_007770) | 1711522..1712304 | + | 783 | WP_101630573.1 | hypothetical protein | - |
CJ193_RS07775 (CJ193_007775) | 1712340..1713200 | - | 861 | WP_101630572.1 | DUF108 domain-containing protein | - |
CJ193_RS07780 (CJ193_007780) | 1713367..1713735 | + | 369 | WP_101630571.1 | DUF488 family protein | - |
CJ193_RS07785 (CJ193_007785) | 1713773..1714174 | + | 402 | WP_101630570.1 | GNAT family N-acetyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 89 a.a. Molecular weight: 10213.86 Da Isoelectric Point: 10.0635
>T283409 WP_101630574.1 NZ_CP126964:1709035-1709301 [Pseudoglutamicibacter albus]
VTNWRLVYSKQAQKDAKKLASSGLKSKARMLLDLLSEDPITSPLRFEKLVGDLAGCYSRRINIQHRLVYEVDAEARVVHV
LRMWTHYE
VTNWRLVYSKQAQKDAKKLASSGLKSKARMLLDLLSEDPITSPLRFEKLVGDLAGCYSRRINIQHRLVYEVDAEARVVHV
LRMWTHYE
Download Length: 267 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|