Detailed information of TA system TA283399

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 107354..107780
• Replicon: plasmid pEND_Eco 123-1
• Accession: NZ_CP126956
• Organism: Escherichia coli O78:H4 strain APEC E123

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: QQA21_RS25080
• Protein ID: WP_001372321.1
• Coordinates: 107655..107780 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	107354..107578 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
QQA21_RS25025 (102773)	102773..103744	+	972	WP_000817028.1	ParB/RepB/Spo0J family plasmid partition protein	-
QQA21_RS25030 (104338)	104338..104507	+	170	Protein_101	hypothetical protein	-
QQA21_RS25035 (104690)	104690..104770	-	81	Protein_102	hypothetical protein	-
QQA21_RS25040 (104840)	104840..105046	+	207	WP_000275856.1	hypothetical protein	-
QQA21_RS25045 (105072)	105072..105611	+	540	WP_000290840.1	single-stranded DNA-binding protein	-
QQA21_RS25050 (105679)	105679..105912	+	234	WP_000005990.1	DUF905 family protein	-
QQA21_RS25055 (105940)	105940..106137	+	198	Protein_106	hypothetical protein	-
QQA21_RS25060 (106192)	106192..106626	+	435	WP_000845936.1	conjugation system SOS inhibitor PsiB	-
QQA21_RS25065 (106623)	106623..107385	+	763	Protein_108	plasmid SOS inhibition protein A	-
QQA21_RS25070 (107354)	107354..107542	-	189	WP_001299721.1	hypothetical protein	-
- (107354)	107354..107578	+	225	NuclAT_0	-	Antitoxin
- (107354)	107354..107578	+	225	NuclAT_0	-	Antitoxin
- (107354)	107354..107578	+	225	NuclAT_0	-	Antitoxin
- (107354)	107354..107578	+	225	NuclAT_0	-	Antitoxin
QQA21_RS25075 (107564)	107564..107713	+	150	Protein_110	plasmid maintenance protein Mok	-
QQA21_RS25080 (107655)	107655..107780	+	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
QQA21_RS25085 (108000)	108000..108230	+	231	WP_071586998.1	hypothetical protein	-
QQA21_RS25090 (108228)	108228..108400	-	173	Protein_113	hypothetical protein	-
QQA21_RS25095 (108470)	108470..108676	+	207	WP_000547968.1	hypothetical protein	-
QQA21_RS25100 (108701)	108701..108988	+	288	WP_000107535.1	hypothetical protein	-
QQA21_RS25105 (109106)	109106..109927	+	822	WP_001234426.1	DUF932 domain-containing protein	-
QQA21_RS25110 (110224)	110224..110814	-	591	WP_289245779.1	transglycosylase SLT domain-containing protein	-
QQA21_RS25115 (111147)	111147..111530	+	384	WP_001151524.1	conjugal transfer relaxosome DNA-binding protein TraM	-
QQA21_RS25120 (111717)	111717..112406	+	690	WP_015918718.1	conjugal transfer transcriptional regulator TraJ	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	sitABCD	vat / iroN / iroE / iroD / iroC / iroB / iucA / iucB / iucC / iucD / iutA	1..121788	121788

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T283399 WP_001372321.1 NZ_CP126956:107655-107780 [Escherichia coli O78:H4]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 225 bp

>AT283399 NZ_CP126956:107354-107578 [Escherichia coli O78:H4]
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT

Structures

Antitoxin