Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 107354..107780 | Replicon | plasmid pEND_Eco 123-1 |
| Accession | NZ_CP126956 | ||
| Organism | Escherichia coli O78:H4 strain APEC E123 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | QQA21_RS25080 | Protein ID | WP_001372321.1 |
| Coordinates | 107655..107780 (+) | Length | 42 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 107354..107578 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QQA21_RS25025 (102773) | 102773..103744 | + | 972 | WP_000817028.1 | ParB/RepB/Spo0J family plasmid partition protein | - |
| QQA21_RS25030 (104338) | 104338..104507 | + | 170 | Protein_101 | hypothetical protein | - |
| QQA21_RS25035 (104690) | 104690..104770 | - | 81 | Protein_102 | hypothetical protein | - |
| QQA21_RS25040 (104840) | 104840..105046 | + | 207 | WP_000275856.1 | hypothetical protein | - |
| QQA21_RS25045 (105072) | 105072..105611 | + | 540 | WP_000290840.1 | single-stranded DNA-binding protein | - |
| QQA21_RS25050 (105679) | 105679..105912 | + | 234 | WP_000005990.1 | DUF905 family protein | - |
| QQA21_RS25055 (105940) | 105940..106137 | + | 198 | Protein_106 | hypothetical protein | - |
| QQA21_RS25060 (106192) | 106192..106626 | + | 435 | WP_000845936.1 | conjugation system SOS inhibitor PsiB | - |
| QQA21_RS25065 (106623) | 106623..107385 | + | 763 | Protein_108 | plasmid SOS inhibition protein A | - |
| QQA21_RS25070 (107354) | 107354..107542 | - | 189 | WP_001299721.1 | hypothetical protein | - |
| - (107354) | 107354..107578 | + | 225 | NuclAT_0 | - | Antitoxin |
| - (107354) | 107354..107578 | + | 225 | NuclAT_0 | - | Antitoxin |
| - (107354) | 107354..107578 | + | 225 | NuclAT_0 | - | Antitoxin |
| - (107354) | 107354..107578 | + | 225 | NuclAT_0 | - | Antitoxin |
| QQA21_RS25075 (107564) | 107564..107713 | + | 150 | Protein_110 | plasmid maintenance protein Mok | - |
| QQA21_RS25080 (107655) | 107655..107780 | + | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| QQA21_RS25085 (108000) | 108000..108230 | + | 231 | WP_071586998.1 | hypothetical protein | - |
| QQA21_RS25090 (108228) | 108228..108400 | - | 173 | Protein_113 | hypothetical protein | - |
| QQA21_RS25095 (108470) | 108470..108676 | + | 207 | WP_000547968.1 | hypothetical protein | - |
| QQA21_RS25100 (108701) | 108701..108988 | + | 288 | WP_000107535.1 | hypothetical protein | - |
| QQA21_RS25105 (109106) | 109106..109927 | + | 822 | WP_001234426.1 | DUF932 domain-containing protein | - |
| QQA21_RS25110 (110224) | 110224..110814 | - | 591 | WP_289245779.1 | transglycosylase SLT domain-containing protein | - |
| QQA21_RS25115 (111147) | 111147..111530 | + | 384 | WP_001151524.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| QQA21_RS25120 (111717) | 111717..112406 | + | 690 | WP_015918718.1 | conjugal transfer transcriptional regulator TraJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | sitABCD | vat / iroN / iroE / iroD / iroC / iroB / iucA / iucB / iucC / iucD / iutA | 1..121788 | 121788 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T283399 WP_001372321.1 NZ_CP126956:107655-107780 [Escherichia coli O78:H4]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
Antitoxin
Download Length: 225 bp
>AT283399 NZ_CP126956:107354-107578 [Escherichia coli O78:H4]
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|