Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 17862..18116 Replicon plasmid pEND_Eco 123-1
Accession NZ_CP126956
Organism Escherichia coli O78:H4 strain APEC E123

Toxin (Protein)


Gene name srnB Uniprot ID G9G1E3
Locus tag QQA21_RS24615 Protein ID WP_001312851.1
Coordinates 17967..18116 (+) Length 50 a.a.

Antitoxin (RNA)


Gene name srnC
Locus tag -
Coordinates 17862..17923 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QQA21_RS24590 (14610) 14610..15356 + 747 WP_000205749.1 conjugal transfer pilus acetylase TraX -
QQA21_RS24595 (15415) 15415..16275 + 861 WP_000704513.1 alpha/beta hydrolase -
QQA21_RS24600 (16378) 16378..16938 + 561 WP_000139315.1 fertility inhibition protein FinO -
QQA21_RS24605 (17074) 17074..17286 + 213 WP_001299730.1 ANR family transcriptional regulator -
QQA21_RS24610 (17532) 17532..17606 + 75 Protein_17 endonuclease -
- (17862) 17862..17923 - 62 NuclAT_1 - Antitoxin
- (17862) 17862..17923 - 62 NuclAT_1 - Antitoxin
- (17862) 17862..17923 - 62 NuclAT_1 - Antitoxin
- (17862) 17862..17923 - 62 NuclAT_1 - Antitoxin
QQA21_RS24615 (17967) 17967..18116 + 150 WP_001312851.1 Hok/Gef family protein Toxin
QQA21_RS24620 (18400) 18400..18657 + 258 WP_000083845.1 replication regulatory protein RepA -
QQA21_RS24625 (18674) 18674..18925 - 252 WP_223195197.1 replication protein RepA -
QQA21_RS24630 (18916) 18916..18963 + 48 WP_229471593.1 hypothetical protein -
QQA21_RS24635 (18956) 18956..19438 + 483 WP_001273588.1 hypothetical protein -
QQA21_RS24640 (19431) 19431..20288 + 858 WP_000774297.1 incFII family plasmid replication initiator RepA -
QQA21_RS24645 (21224) 21224..21568 + 345 WP_001553768.1 hypothetical protein -
QQA21_RS24650 (21749) 21749..22864 - 1116 Protein_25 IS91 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid sitABCD vat / iroN / iroE / iroD / iroC / iroB / iucA / iucB / iucC / iucD / iutA 1..121788 121788


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(4-45)


Sequences

Toxin        


Download         Length: 50 a.a.        Molecular weight: 5542.67 Da        Isoelectric Point: 8.7678

>T283396 WP_001312851.1 NZ_CP126956:17967-18116 [Escherichia coli O78:H4]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK

Download         Length: 150 bp

Antitoxin


Download         Length: 62 bp

>AT283396 NZ_CP126956:c17923-17862 [Escherichia coli O78:H4]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829C8K5

Antitoxin

Download structure file

References