Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
| Location | 3982003..3982802 | Replicon | chromosome |
| Accession | NZ_CP126955 | ||
| Organism | Escherichia coli O78:H4 strain APEC E123 | ||
Toxin (Protein)
| Gene name | yhaV | Uniprot ID | S1NYM6 |
| Locus tag | QQA21_RS19595 | Protein ID | WP_000347251.1 |
| Coordinates | 3982338..3982802 (+) | Length | 155 a.a. |
Antitoxin (Protein)
| Gene name | prlF | Uniprot ID | S1EB98 |
| Locus tag | QQA21_RS19590 | Protein ID | WP_001307405.1 |
| Coordinates | 3982003..3982338 (+) | Length | 112 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QQA21_RS19575 (3977788) | 3977788..3978558 | - | 771 | WP_001058214.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
| QQA21_RS19580 (3978574) | 3978574..3979908 | - | 1335 | WP_000599652.1 | galactarate/glucarate/glycerate transporter GarP | - |
| QQA21_RS19585 (3980283) | 3980283..3981854 | + | 1572 | WP_001273761.1 | galactarate dehydratase | - |
| QQA21_RS19590 (3982003) | 3982003..3982338 | + | 336 | WP_001307405.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
| QQA21_RS19595 (3982338) | 3982338..3982802 | + | 465 | WP_000347251.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
| QQA21_RS19600 (3982856) | 3982856..3983665 | - | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
| QQA21_RS19605 (3983914) | 3983914..3985194 | + | 1281 | WP_000681903.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
| QQA21_RS19610 (3985217) | 3985217..3985690 | + | 474 | WP_001295547.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
| QQA21_RS19615 (3985701) | 3985701..3986480 | + | 780 | WP_000406214.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
| QQA21_RS19620 (3986470) | 3986470..3987348 | + | 879 | WP_001295548.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
| QQA21_RS19625 (3987366) | 3987366..3987800 | + | 435 | WP_000948824.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 3971128..3982802 | 11674 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17777.14 Da Isoelectric Point: 9.4947
>T283391 WP_000347251.1 NZ_CP126955:3982338-3982802 [Escherichia coli O78:H4]
MDFPQRVNGWALYAHPCFQETYDALVAEVEALKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
MDFPQRVNGWALYAHPCFQETYDALVAEVEALKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CJ20 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E0XVC7 |