Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 62084..62348 Replicon plasmid pEND_Eco 12049-2
Accession NZ_CP126954
Organism Escherichia coli O78:H4 strain APEC E12049

Toxin (Protein)


Gene name pndA Uniprot ID E6BRV3
Locus tag QQA22_RS26325 Protein ID WP_001303307.1
Coordinates 62196..62348 (+) Length 51 a.a.

Antitoxin (RNA)


Gene name pndB
Locus tag -
Coordinates 62084..62146 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QQA22_RS26310 (57323) 57323..59614 - 2292 WP_001289271.1 F-type conjugative transfer protein TrbC -
QQA22_RS26315 (59607) 59607..60677 - 1071 WP_000151575.1 IncI1-type conjugal transfer protein TrbB -
QQA22_RS26320 (60696) 60696..61904 - 1209 WP_000121273.1 IncI1-type conjugal transfer protein TrbA -
- (62084) 62084..62146 - 63 NuclAT_0 - Antitoxin
- (62084) 62084..62146 - 63 NuclAT_0 - Antitoxin
- (62084) 62084..62146 - 63 NuclAT_0 - Antitoxin
- (62084) 62084..62146 - 63 NuclAT_0 - Antitoxin
QQA22_RS26325 (62196) 62196..62348 + 153 WP_001303307.1 Hok/Gef family protein Toxin
QQA22_RS26330 (62420) 62420..62671 - 252 WP_001291965.1 hypothetical protein -
- (63058) 63058..63109 - 52 NuclAT_1 - -
- (63058) 63058..63109 - 52 NuclAT_1 - -
- (63058) 63058..63109 - 52 NuclAT_1 - -
- (63058) 63058..63109 - 52 NuclAT_1 - -
QQA22_RS26335 (63595) 63595..63771 - 177 WP_001054900.1 hypothetical protein -
QQA22_RS26340 (64163) 64163..64372 + 210 WP_000062603.1 HEAT repeat domain-containing protein -
QQA22_RS26345 (64444) 64444..65106 - 663 WP_000644794.1 plasmid IncI1-type surface exclusion protein ExcA -
QQA22_RS26350 (65177) 65177..67345 - 2169 WP_000698368.1 DotA/TraY family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid sul1 / qacE / aac(3)-VIa / ant(3'')-Ia - 1..114229 114229


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(7-46)


Sequences

Toxin        


Download         Length: 51 a.a.        Molecular weight: 5817.21 Da        Isoelectric Point: 8.7948

>T283369 WP_001303307.1 NZ_CP126954:62196-62348 [Escherichia coli O78:H4]
MPQRTFLMMLIVICVTILCFVWMVRDSLCVLRLQQGNTVLVATLAYEVKR

Download         Length: 153 bp

Antitoxin


Download         Length: 63 bp

>AT283369 NZ_CP126954:c62146-62084 [Escherichia coli O78:H4]
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A634Q5L1

Antitoxin

Download structure file

References