Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 140319..140588 | Replicon | plasmid pEND_Eco 12049-1 |
| Accession | NZ_CP126953 | ||
| Organism | Escherichia coli O78:H4 strain APEC E12049 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | QQA22_RS25860 | Protein ID | WP_001372321.1 |
| Coordinates | 140463..140588 (+) | Length | 42 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 140319..140384 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QQA22_RS25820 | 135361..135639 | + | 279 | WP_072127934.1 | hypothetical protein | - |
| QQA22_RS25825 | 136112..136639 | + | 528 | WP_000290793.1 | single-stranded DNA-binding protein | - |
| QQA22_RS25830 | 136695..136928 | + | 234 | WP_000006004.1 | DUF905 domain-containing protein | - |
| QQA22_RS25835 | 136987..138945 | + | 1959 | WP_001145469.1 | ParB/RepB/Spo0J family partition protein | - |
| QQA22_RS25840 | 139000..139434 | + | 435 | WP_000845895.1 | conjugation system SOS inhibitor PsiB | - |
| QQA22_RS25845 | 139431..140193 | + | 763 | Protein_137 | plasmid SOS inhibition protein A | - |
| QQA22_RS25850 | 140162..140350 | - | 189 | WP_001299721.1 | hypothetical protein | - |
| - | 140162..140386 | + | 225 | NuclAT_0 | - | - |
| - | 140162..140386 | + | 225 | NuclAT_0 | - | - |
| - | 140162..140386 | + | 225 | NuclAT_0 | - | - |
| - | 140162..140386 | + | 225 | NuclAT_0 | - | - |
| - | 140319..140384 | - | 66 | - | - | Antitoxin |
| QQA22_RS25855 | 140372..140521 | + | 150 | Protein_139 | plasmid maintenance protein Mok | - |
| QQA22_RS25860 | 140463..140588 | + | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| QQA22_RS25865 | 140808..141038 | + | 231 | WP_001426396.1 | hypothetical protein | - |
| QQA22_RS25870 | 141036..141209 | - | 174 | Protein_142 | hypothetical protein | - |
| QQA22_RS25875 | 141279..141485 | + | 207 | WP_000547939.1 | hypothetical protein | - |
| QQA22_RS25880 | 141510..141797 | + | 288 | WP_000107535.1 | hypothetical protein | - |
| QQA22_RS25885 | 141918..142739 | + | 822 | WP_001234469.1 | DUF932 domain-containing protein | - |
| QQA22_RS25890 | 143036..143638 | - | 603 | WP_000243709.1 | transglycosylase SLT domain-containing protein | - |
| QQA22_RS25895 | 143959..144342 | + | 384 | WP_001151524.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| QQA22_RS25900 | 144529..145218 | + | 690 | WP_000283385.1 | conjugal transfer transcriptional regulator TraJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | sitABCD | vat / iroB / iroC / iroD / iroE / iroN / iucA / iucB / iucC / iucD / iutA | 1..155857 | 155857 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T283367 WP_001372321.1 NZ_CP126953:140463-140588 [Escherichia coli O78:H4]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
Antitoxin
Download Length: 66 bp
>AT283367 NZ_CP126953:c140384-140319 [Escherichia coli O78:H4]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|