Detailed information of TA system TA283367

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 140319..140588
• Replicon: plasmid pEND_Eco 12049-1
• Accession: NZ_CP126953
• Organism: Escherichia coli O78:H4 strain APEC E12049

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: QQA22_RS25860
• Protein ID: WP_001372321.1
• Coordinates: 140463..140588 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	140319..140384 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
QQA22_RS25820	135361..135639	+	279	WP_072127934.1	hypothetical protein	-
QQA22_RS25825	136112..136639	+	528	WP_000290793.1	single-stranded DNA-binding protein	-
QQA22_RS25830	136695..136928	+	234	WP_000006004.1	DUF905 domain-containing protein	-
QQA22_RS25835	136987..138945	+	1959	WP_001145469.1	ParB/RepB/Spo0J family partition protein	-
QQA22_RS25840	139000..139434	+	435	WP_000845895.1	conjugation system SOS inhibitor PsiB	-
QQA22_RS25845	139431..140193	+	763	Protein_137	plasmid SOS inhibition protein A	-
QQA22_RS25850	140162..140350	-	189	WP_001299721.1	hypothetical protein	-
-	140162..140386	+	225	NuclAT_0	-	-
-	140162..140386	+	225	NuclAT_0	-	-
-	140162..140386	+	225	NuclAT_0	-	-
-	140162..140386	+	225	NuclAT_0	-	-
-	140319..140384	-	66	-	-	Antitoxin
QQA22_RS25855	140372..140521	+	150	Protein_139	plasmid maintenance protein Mok	-
QQA22_RS25860	140463..140588	+	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
QQA22_RS25865	140808..141038	+	231	WP_001426396.1	hypothetical protein	-
QQA22_RS25870	141036..141209	-	174	Protein_142	hypothetical protein	-
QQA22_RS25875	141279..141485	+	207	WP_000547939.1	hypothetical protein	-
QQA22_RS25880	141510..141797	+	288	WP_000107535.1	hypothetical protein	-
QQA22_RS25885	141918..142739	+	822	WP_001234469.1	DUF932 domain-containing protein	-
QQA22_RS25890	143036..143638	-	603	WP_000243709.1	transglycosylase SLT domain-containing protein	-
QQA22_RS25895	143959..144342	+	384	WP_001151524.1	conjugal transfer relaxosome DNA-binding protein TraM	-
QQA22_RS25900	144529..145218	+	690	WP_000283385.1	conjugal transfer transcriptional regulator TraJ	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	sitABCD	vat / iroB / iroC / iroD / iroE / iroN / iucA / iucB / iucC / iucD / iutA	1..155857	155857

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T283367 WP_001372321.1 NZ_CP126953:140463-140588 [Escherichia coli O78:H4]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 66 bp

>AT283367 NZ_CP126953:c140384-140319 [Escherichia coli O78:H4]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT

Structures

Antitoxin