Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 27158..27412 | Replicon | plasmid pEND_Eco 12049-1 |
| Accession | NZ_CP126953 | ||
| Organism | Escherichia coli O78:H4 strain APEC E12049 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | QQA22_RS25295 | Protein ID | WP_001312851.1 |
| Coordinates | 27263..27412 (+) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 27158..27219 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QQA22_RS25260 (22166) | 22166..22912 | + | 747 | WP_039005755.1 | conjugal transfer pilus acetylase TraX | - |
| QQA22_RS25265 (22967) | 22967..23527 | + | 561 | WP_039005753.1 | fertility inhibition protein FinO | - |
| QQA22_RS25270 (23663) | 23663..23875 | + | 213 | WP_001299730.1 | ANR family transcriptional regulator | - |
| QQA22_RS25275 (24085) | 24085..25656 | - | 1572 | WP_113255196.1 | IS66-like element ISCro1 family transposase | - |
| QQA22_RS25280 (25676) | 25676..26023 | - | 348 | WP_000624622.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| QQA22_RS25285 (26023) | 26023..26700 | - | 678 | WP_001339397.1 | IS66-like element accessory protein TnpA | - |
| QQA22_RS25290 (26828) | 26828..26902 | + | 75 | Protein_26 | endonuclease | - |
| - (27158) | 27158..27219 | - | 62 | NuclAT_1 | - | Antitoxin |
| - (27158) | 27158..27219 | - | 62 | NuclAT_1 | - | Antitoxin |
| - (27158) | 27158..27219 | - | 62 | NuclAT_1 | - | Antitoxin |
| - (27158) | 27158..27219 | - | 62 | NuclAT_1 | - | Antitoxin |
| QQA22_RS25295 (27263) | 27263..27412 | + | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| QQA22_RS25300 (27696) | 27696..27953 | + | 258 | WP_000083845.1 | replication regulatory protein RepA | - |
| QQA22_RS25305 (27970) | 27970..28221 | - | 252 | WP_223195197.1 | replication protein RepA | - |
| QQA22_RS25310 (28212) | 28212..28259 | + | 48 | WP_229471593.1 | hypothetical protein | - |
| QQA22_RS25315 (28252) | 28252..28734 | + | 483 | WP_001273588.1 | hypothetical protein | - |
| QQA22_RS25320 (28727) | 28727..29584 | + | 858 | WP_000774297.1 | incFII family plasmid replication initiator RepA | - |
| QQA22_RS25325 (30547) | 30547..30798 | + | 252 | WP_001132900.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
| QQA22_RS25330 (30795) | 30795..31082 | + | 288 | WP_000222766.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | sitABCD | vat / iroB / iroC / iroD / iroE / iroN / iucA / iucB / iucC / iucD / iutA | 1..155857 | 155857 | |
| - | inside | IScluster/Tn | - | vat | 24085..41408 | 17323 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T283360 WP_001312851.1 NZ_CP126953:27263-27412 [Escherichia coli O78:H4]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 62 bp
>AT283360 NZ_CP126953:c27219-27158 [Escherichia coli O78:H4]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
