Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 4949928..4950530 | Replicon | chromosome |
Accession | NZ_CP126952 | ||
Organism | Escherichia coli O78:H4 strain APEC E12049 |
Toxin (Protein)
Gene name | higB | Uniprot ID | U9XIS6 |
Locus tag | QQA22_RS24115 | Protein ID | WP_000897305.1 |
Coordinates | 4950219..4950530 (-) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | QQA22_RS24110 | Protein ID | WP_000356397.1 |
Coordinates | 4949928..4950218 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QQA22_RS24090 (4946430) | 4946430..4947332 | + | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
QQA22_RS24095 (4947329) | 4947329..4947964 | + | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
QQA22_RS24100 (4947961) | 4947961..4948890 | + | 930 | WP_000027720.1 | formate dehydrogenase accessory protein FdhE | - |
QQA22_RS24105 (4949105) | 4949105..4949323 | - | 219 | WP_001295676.1 | CopG family transcriptional regulator | - |
QQA22_RS24110 (4949928) | 4949928..4950218 | - | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
QQA22_RS24115 (4950219) | 4950219..4950530 | - | 312 | WP_000897305.1 | hypothetical protein | Toxin |
QQA22_RS24120 (4950759) | 4950759..4951667 | + | 909 | WP_001318161.1 | alpha/beta hydrolase | - |
QQA22_RS24125 (4951731) | 4951731..4952672 | - | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
QQA22_RS24130 (4952717) | 4952717..4953154 | - | 438 | WP_000560983.1 | D-aminoacyl-tRNA deacylase | - |
QQA22_RS24135 (4953151) | 4953151..4954023 | - | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
QQA22_RS24140 (4954017) | 4954017..4954616 | - | 600 | WP_001315111.1 | glucose-1-phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12190.19 Da Isoelectric Point: 9.7791
>T283358 WP_000897305.1 NZ_CP126952:c4950530-4950219 [Escherichia coli O78:H4]
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|