Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HTH_XRE |
| Location | 3651286..3651965 | Replicon | chromosome |
| Accession | NZ_CP126952 | ||
| Organism | Escherichia coli O78:H4 strain APEC E12049 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | S1PK60 |
| Locus tag | QQA22_RS18010 | Protein ID | WP_000057523.1 |
| Coordinates | 3651663..3651965 (-) | Length | 101 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | S1QAY3 |
| Locus tag | QQA22_RS18005 | Protein ID | WP_000806442.1 |
| Coordinates | 3651286..3651627 (-) | Length | 114 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QQA22_RS17995 (3647529) | 3647529..3648461 | - | 933 | WP_000883024.1 | glutaminase A | - |
| QQA22_RS18000 (3648724) | 3648724..3651228 | + | 2505 | WP_000083999.1 | copper-exporting P-type ATPase CopA | - |
| QQA22_RS18005 (3651286) | 3651286..3651627 | - | 342 | WP_000806442.1 | HigA family addiction module antitoxin | Antitoxin |
| QQA22_RS18010 (3651663) | 3651663..3651965 | - | 303 | WP_000057523.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| QQA22_RS18015 (3652098) | 3652098..3652892 | + | 795 | WP_000365161.1 | TraB/GumN family protein | - |
| QQA22_RS18020 (3653096) | 3653096..3653575 | + | 480 | WP_000186638.1 | Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase YbaK | - |
| QQA22_RS18025 (3653612) | 3653612..3655264 | - | 1653 | WP_039004121.1 | bifunctional UDP-sugar hydrolase/5'-nucleotidase | - |
| QQA22_RS18030 (3655482) | 3655482..3656702 | + | 1221 | WP_001251634.1 | fosmidomycin MFS transporter | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 3643172..3651965 | 8793 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11809.44 Da Isoelectric Point: 10.3980
>T283352 WP_000057523.1 NZ_CP126952:c3651965-3651663 [Escherichia coli O78:H4]
MAQKKNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHRDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
MAQKKNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHRDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
Download Length: 303 bp
Antitoxin
Download Length: 114 a.a. Molecular weight: 13171.10 Da Isoelectric Point: 5.7790
>AT283352 WP_000806442.1 NZ_CP126952:c3651627-3651286 [Escherichia coli O78:H4]
MKQATRKPTTPGDILLYEYLEPLDLKINELAELLHVHRNSVSALINNNRKLTTEMAFRLAKVFDTTVDFWLNLQAAVDLW
EVENNMRTQEELGRIETVAEYLARREERAKKVA
MKQATRKPTTPGDILLYEYLEPLDLKINELAELLHVHRNSVSALINNNRKLTTEMAFRLAKVFDTTVDFWLNLQAAVDLW
EVENNMRTQEELGRIETVAEYLARREERAKKVA
Download Length: 342 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|