Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 1916970..1917801 Replicon chromosome
Accession NZ_CP126952
Organism Escherichia coli O78:H4 strain APEC E12049

Toxin (Protein)


Gene name yeeV Uniprot ID S1P968
Locus tag QQA22_RS09085 Protein ID WP_000854814.1
Coordinates 1916970..1917344 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A376RIF3
Locus tag QQA22_RS09090 Protein ID WP_053882193.1
Coordinates 1917433..1917801 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QQA22_RS09045 (1913005) 1913005..1913523 - 519 WP_000115885.1 ClbS/DfsB family four-helix bundle protein -
QQA22_RS09050 (1913651) 1913651..1914124 + 474 WP_024222062.1 DNA gyrase inhibitor SbmC -
QQA22_RS09055 (1914322) 1914322..1915380 + 1059 WP_001200891.1 FUSC family protein -
QQA22_RS09060 (1915552) 1915552..1915881 + 330 WP_000450409.1 DUF496 family protein -
QQA22_RS09065 (1915982) 1915982..1916116 - 135 WP_001297944.1 EutP/PduV family microcompartment system protein -
QQA22_RS09070 (1916236) 1916236..1916364 + 129 Protein_1773 transposase domain-containing protein -
QQA22_RS09075 (1916653) 1916653..1916733 - 81 Protein_1774 hypothetical protein -
QQA22_RS09080 (1916779) 1916779..1916973 - 195 WP_039023483.1 DUF5983 family protein -
QQA22_RS09085 (1916970) 1916970..1917344 - 375 WP_000854814.1 type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA Toxin
QQA22_RS09090 (1917433) 1917433..1917801 - 369 WP_053882193.1 type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA Antitoxin
QQA22_RS09095 (1917875) 1917875..1918096 - 222 WP_000692323.1 DUF987 domain-containing protein -
QQA22_RS09100 (1918159) 1918159..1918635 - 477 WP_001186726.1 RadC family protein -
QQA22_RS09105 (1918651) 1918651..1919130 - 480 WP_000860087.1 antirestriction protein -
QQA22_RS09110 (1919212) 1919212..1920030 - 819 WP_001234629.1 DUF932 domain-containing protein -
QQA22_RS09115 (1920130) 1920130..1920363 - 234 WP_001119729.1 DUF905 family protein -
QQA22_RS09120 (1920421) 1920421..1921098 + 678 WP_001339397.1 IS66-like element accessory protein TnpA -
QQA22_RS09125 (1921098) 1921098..1921445 + 348 WP_000624622.1 IS66 family insertion sequence element accessory protein TnpB -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
flank IS/Tn - - 1911766..1912986 1220


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(19-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13898.94 Da        Isoelectric Point: 7.8522

>T283343 WP_000854814.1 NZ_CP126952:c1917344-1916970 [Escherichia coli O78:H4]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13597.47 Da        Isoelectric Point: 6.3139

>AT283343 WP_053882193.1 NZ_CP126952:c1917801-1917433 [Escherichia coli O78:H4]
VSDTLPGTTLPDDNHDRTWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829FY50

Antitoxin

Source ID Structure
AlphaFold DB A0A376RIF3

References