Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
| Location | 686142..686941 | Replicon | chromosome |
| Accession | NZ_CP126952 | ||
| Organism | Escherichia coli O78:H4 strain APEC E12049 | ||
Toxin (Protein)
| Gene name | yhaV | Uniprot ID | S1NYM6 |
| Locus tag | QQA22_RS03400 | Protein ID | WP_000347251.1 |
| Coordinates | 686142..686606 (-) | Length | 155 a.a. |
Antitoxin (Protein)
| Gene name | prlF | Uniprot ID | S1PPV5 |
| Locus tag | QQA22_RS03405 | Protein ID | WP_001296435.1 |
| Coordinates | 686606..686941 (-) | Length | 112 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QQA22_RS03370 (681142) | 681142..681576 | - | 435 | WP_000948823.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
| QQA22_RS03375 (681594) | 681594..682472 | - | 879 | WP_001295548.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
| QQA22_RS03380 (682462) | 682462..683241 | - | 780 | WP_000406214.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
| QQA22_RS03385 (683252) | 683252..683725 | - | 474 | WP_001295547.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
| QQA22_RS03390 (683748) | 683748..685029 | - | 1282 | Protein_664 | tagatose-bisphosphate aldolase subunit KbaZ | - |
| QQA22_RS03395 (685278) | 685278..686087 | + | 810 | WP_264097422.1 | aga operon transcriptional regulator AgaR | - |
| QQA22_RS03400 (686142) | 686142..686606 | - | 465 | WP_000347251.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
| QQA22_RS03405 (686606) | 686606..686941 | - | 336 | WP_001296435.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
| QQA22_RS03410 (687090) | 687090..688661 | - | 1572 | WP_001273941.1 | galactarate dehydratase | - |
| QQA22_RS03415 (689036) | 689036..690370 | + | 1335 | WP_000979025.1 | galactarate/glucarate/glycerate transporter GarP | - |
| QQA22_RS03420 (690386) | 690386..691156 | + | 771 | WP_001058227.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
| QQA22_RS03425 (691186) | 691186..691449 | + | 264 | Protein_671 | NAD(P)-binding domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 691462..692670 | 1208 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17777.14 Da Isoelectric Point: 9.4947
>T283339 WP_000347251.1 NZ_CP126952:c686606-686142 [Escherichia coli O78:H4]
MDFPQRVNGWALYAHPCFQETYDALVAEVEALKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
MDFPQRVNGWALYAHPCFQETYDALVAEVEALKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CJ20 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | S1PPV5 |