Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
Location | 426107..426329 | Replicon | chromosome |
Accession | NZ_CP126952 | ||
Organism | Escherichia coli O78:H4 strain APEC E12049 |
Toxin (Protein)
Gene name | ldrD | Uniprot ID | A0A829L523 |
Locus tag | QQA22_RS02000 | Protein ID | WP_000170738.1 |
Coordinates | 426107..426214 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | rdlD | ||
Locus tag | - | ||
Coordinates | 426263..426329 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QQA22_RS01970 | 421136..422707 | + | 1572 | WP_001204944.1 | cellulose biosynthesis c-di-GMP-binding protein BcsE | - |
QQA22_RS01975 | 422704..422895 | + | 192 | WP_000988308.1 | cellulose biosynthesis protein BcsF | - |
QQA22_RS01980 | 422892..424571 | + | 1680 | WP_289245627.1 | cellulose biosynthesis protein BcsG | - |
QQA22_RS01985 | 424658..424765 | - | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
QQA22_RS01990 | 425141..425248 | - | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
QQA22_RS01995 | 425624..425731 | - | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
QQA22_RS02000 | 426107..426214 | - | 108 | WP_000170738.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
- | 426263..426329 | + | 67 | - | - | Antitoxin |
QQA22_RS02005 | 426690..427961 | + | 1272 | WP_001318103.1 | aromatic amino acid transport family protein | - |
QQA22_RS02010 | 427991..428995 | - | 1005 | WP_000107036.1 | dipeptide ABC transporter ATP-binding subunit DppF | - |
QQA22_RS02015 | 428992..429975 | - | 984 | WP_001196486.1 | dipeptide ABC transporter ATP-binding protein | - |
QQA22_RS02020 | 429986..430888 | - | 903 | WP_000084677.1 | dipeptide ABC transporter permease DppC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3864.67 Da Isoelectric Point: 9.0157
>T283338 WP_000170738.1 NZ_CP126952:c426214-426107 [Escherichia coli O78:H4]
MTLAELGMAFWHDLAAPVIAGILASLIVNWLNKRK
MTLAELGMAFWHDLAAPVIAGILASLIVNWLNKRK
Download Length: 108 bp
Antitoxin
Download Length: 67 bp
>AT283338 NZ_CP126952:426263-426329 [Escherichia coli O78:H4]
GTCTAGGTTCAAGATTAGCCCCCGTGATGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
GTCTAGGTTCAAGATTAGCCCCCGTGATGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|