Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 425141..425363 Replicon chromosome
Accession NZ_CP126952
Organism Escherichia coli O78:H4 strain APEC E12049

Toxin (Protein)


Gene name ldrD Uniprot ID S1NWX0
Locus tag QQA22_RS01990 Protein ID WP_001295224.1
Coordinates 425141..425248 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 425297..425363 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QQA22_RS01965 420675..420863 - 189 WP_289245626.1 cellulose biosynthesis protein BcsR -
QQA22_RS01970 421136..422707 + 1572 WP_001204944.1 cellulose biosynthesis c-di-GMP-binding protein BcsE -
QQA22_RS01975 422704..422895 + 192 WP_000988308.1 cellulose biosynthesis protein BcsF -
QQA22_RS01980 422892..424571 + 1680 WP_289245627.1 cellulose biosynthesis protein BcsG -
QQA22_RS01985 424658..424765 - 108 WP_001295224.1 type I toxin-antitoxin system toxin Ldr family protein -
QQA22_RS01990 425141..425248 - 108 WP_001295224.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 425297..425363 + 67 - - Antitoxin
QQA22_RS01995 425624..425731 - 108 WP_001295224.1 type I toxin-antitoxin system toxin Ldr family protein -
QQA22_RS02000 426107..426214 - 108 WP_000170738.1 type I toxin-antitoxin system toxin Ldr family protein -
QQA22_RS02005 426690..427961 + 1272 WP_001318103.1 aromatic amino acid transport family protein -
QQA22_RS02010 427991..428995 - 1005 WP_000107036.1 dipeptide ABC transporter ATP-binding subunit DppF -
QQA22_RS02015 428992..429975 - 984 WP_001196486.1 dipeptide ABC transporter ATP-binding protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3882.70 Da        Isoelectric Point: 9.0157

>T283337 WP_001295224.1 NZ_CP126952:c425248-425141 [Escherichia coli O78:H4]
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK

Download         Length: 108 bp

Antitoxin


Download         Length: 67 bp

>AT283337 NZ_CP126952:425297-425363 [Escherichia coli O78:H4]
GTCTAGATGCAAGAATGGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A4P7TSJ7

Antitoxin

Download structure file

References