Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 77126..77390 | Replicon | plasmid pEND_Eco 14033-2 |
| Accession | NZ_CP126950 | ||
| Organism | Escherichia coli O78:H4 strain APEC E14033 | ||
Toxin (Protein)
| Gene name | pndA | Uniprot ID | U9Y6M3 |
| Locus tag | QQA23_RS25610 | Protein ID | WP_001331364.1 |
| Coordinates | 77238..77390 (+) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | pndB | ||
| Locus tag | - | ||
| Coordinates | 77126..77188 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QQA23_RS25595 (72365) | 72365..74656 | - | 2292 | WP_001289276.1 | F-type conjugative transfer protein TrbC | - |
| QQA23_RS25600 (74649) | 74649..75719 | - | 1071 | WP_000151582.1 | IncI1-type conjugal transfer protein TrbB | - |
| QQA23_RS25605 (75738) | 75738..76946 | - | 1209 | WP_000121273.1 | IncI1-type conjugal transfer protein TrbA | - |
| - (77126) | 77126..77188 | - | 63 | NuclAT_0 | - | Antitoxin |
| - (77126) | 77126..77188 | - | 63 | NuclAT_0 | - | Antitoxin |
| - (77126) | 77126..77188 | - | 63 | NuclAT_0 | - | Antitoxin |
| - (77126) | 77126..77188 | - | 63 | NuclAT_0 | - | Antitoxin |
| QQA23_RS25610 (77238) | 77238..77390 | + | 153 | WP_001331364.1 | Hok/Gef family protein | Toxin |
| QQA23_RS25615 (77462) | 77462..77713 | - | 252 | WP_001291964.1 | hypothetical protein | - |
| QQA23_RS25620 (78212) | 78212..78307 | + | 96 | WP_001303310.1 | DinQ-like type I toxin DqlB | - |
| QQA23_RS25625 (78372) | 78372..78548 | - | 177 | WP_001054897.1 | hypothetical protein | - |
| QQA23_RS25630 (78940) | 78940..79149 | + | 210 | WP_039025903.1 | HEAT repeat domain-containing protein | - |
| QQA23_RS25635 (79221) | 79221..79883 | - | 663 | WP_000644796.1 | plasmid IncI1-type surface exclusion protein ExcA | - |
| QQA23_RS25640 (79954) | 79954..82122 | - | 2169 | WP_000698354.1 | DotA/TraY family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaTEM-1B / aac(3)-IId / blaCTX-M-14 | - | 1..115173 | 115173 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5775.13 Da Isoelectric Point: 8.7948
>T283328 WP_001331364.1 NZ_CP126950:77238-77390 [Escherichia coli O78:H4]
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
Download Length: 153 bp
Antitoxin
Download Length: 63 bp
>AT283328 NZ_CP126950:c77188-77126 [Escherichia coli O78:H4]
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|