Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 77126..77390 Replicon plasmid pEND_Eco 14033-2
Accession NZ_CP126950
Organism Escherichia coli O78:H4 strain APEC E14033

Toxin (Protein)


Gene name pndA Uniprot ID U9Y6M3
Locus tag QQA23_RS25610 Protein ID WP_001331364.1
Coordinates 77238..77390 (+) Length 51 a.a.

Antitoxin (RNA)


Gene name pndB
Locus tag -
Coordinates 77126..77188 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QQA23_RS25595 (72365) 72365..74656 - 2292 WP_001289276.1 F-type conjugative transfer protein TrbC -
QQA23_RS25600 (74649) 74649..75719 - 1071 WP_000151582.1 IncI1-type conjugal transfer protein TrbB -
QQA23_RS25605 (75738) 75738..76946 - 1209 WP_000121273.1 IncI1-type conjugal transfer protein TrbA -
- (77126) 77126..77188 - 63 NuclAT_0 - Antitoxin
- (77126) 77126..77188 - 63 NuclAT_0 - Antitoxin
- (77126) 77126..77188 - 63 NuclAT_0 - Antitoxin
- (77126) 77126..77188 - 63 NuclAT_0 - Antitoxin
QQA23_RS25610 (77238) 77238..77390 + 153 WP_001331364.1 Hok/Gef family protein Toxin
QQA23_RS25615 (77462) 77462..77713 - 252 WP_001291964.1 hypothetical protein -
QQA23_RS25620 (78212) 78212..78307 + 96 WP_001303310.1 DinQ-like type I toxin DqlB -
QQA23_RS25625 (78372) 78372..78548 - 177 WP_001054897.1 hypothetical protein -
QQA23_RS25630 (78940) 78940..79149 + 210 WP_039025903.1 HEAT repeat domain-containing protein -
QQA23_RS25635 (79221) 79221..79883 - 663 WP_000644796.1 plasmid IncI1-type surface exclusion protein ExcA -
QQA23_RS25640 (79954) 79954..82122 - 2169 WP_000698354.1 DotA/TraY family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid blaTEM-1B / aac(3)-IId / blaCTX-M-14 - 1..115173 115173


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(7-46)


Sequences

Toxin        


Download         Length: 51 a.a.        Molecular weight: 5775.13 Da        Isoelectric Point: 8.7948

>T283328 WP_001331364.1 NZ_CP126950:77238-77390 [Escherichia coli O78:H4]
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR

Download         Length: 153 bp

Antitoxin


Download         Length: 63 bp

>AT283328 NZ_CP126950:c77188-77126 [Escherichia coli O78:H4]
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A5W9M382

Antitoxin

Download structure file

References