Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 4800919..4801521 | Replicon | chromosome |
Accession | NZ_CP126948 | ||
Organism | Escherichia coli O78:H4 strain APEC E14033 |
Toxin (Protein)
Gene name | higB | Uniprot ID | U9XIS6 |
Locus tag | QQA23_RS23375 | Protein ID | WP_000897305.1 |
Coordinates | 4801210..4801521 (-) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | QQA23_RS23370 | Protein ID | WP_000356397.1 |
Coordinates | 4800919..4801209 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QQA23_RS23350 (4797421) | 4797421..4798323 | + | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
QQA23_RS23355 (4798320) | 4798320..4798955 | + | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
QQA23_RS23360 (4798952) | 4798952..4799881 | + | 930 | WP_000027720.1 | formate dehydrogenase accessory protein FdhE | - |
QQA23_RS23365 (4800096) | 4800096..4800314 | - | 219 | WP_001295676.1 | CopG family transcriptional regulator | - |
QQA23_RS23370 (4800919) | 4800919..4801209 | - | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
QQA23_RS23375 (4801210) | 4801210..4801521 | - | 312 | WP_000897305.1 | hypothetical protein | Toxin |
QQA23_RS23380 (4801750) | 4801750..4802658 | + | 909 | WP_001318161.1 | alpha/beta hydrolase | - |
QQA23_RS23385 (4802722) | 4802722..4803663 | - | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
QQA23_RS23390 (4803708) | 4803708..4804145 | - | 438 | WP_000560983.1 | D-aminoacyl-tRNA deacylase | - |
QQA23_RS23395 (4804142) | 4804142..4805014 | - | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
QQA23_RS23400 (4805008) | 4805008..4805607 | - | 600 | WP_001315111.1 | glucose-1-phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12190.19 Da Isoelectric Point: 9.7791
>T283326 WP_000897305.1 NZ_CP126948:c4801521-4801210 [Escherichia coli O78:H4]
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|