Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HTH_XRE |
| Location | 3591625..3592304 | Replicon | chromosome |
| Accession | NZ_CP126948 | ||
| Organism | Escherichia coli O78:H4 strain APEC E14033 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | S1PK60 |
| Locus tag | QQA23_RS17745 | Protein ID | WP_000057523.1 |
| Coordinates | 3592002..3592304 (-) | Length | 101 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | S1QAY3 |
| Locus tag | QQA23_RS17740 | Protein ID | WP_000806442.1 |
| Coordinates | 3591625..3591966 (-) | Length | 114 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QQA23_RS17730 (3587868) | 3587868..3588800 | - | 933 | WP_000883024.1 | glutaminase A | - |
| QQA23_RS17735 (3589063) | 3589063..3591567 | + | 2505 | WP_000083999.1 | copper-exporting P-type ATPase CopA | - |
| QQA23_RS17740 (3591625) | 3591625..3591966 | - | 342 | WP_000806442.1 | HigA family addiction module antitoxin | Antitoxin |
| QQA23_RS17745 (3592002) | 3592002..3592304 | - | 303 | WP_000057523.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| QQA23_RS17750 (3592437) | 3592437..3593231 | + | 795 | WP_000365161.1 | TraB/GumN family protein | - |
| QQA23_RS17755 (3593435) | 3593435..3593914 | + | 480 | WP_000186638.1 | Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase YbaK | - |
| QQA23_RS17760 (3593951) | 3593951..3595603 | - | 1653 | WP_059338785.1 | bifunctional UDP-sugar hydrolase/5'-nucleotidase | - |
| QQA23_RS17765 (3595821) | 3595821..3597041 | + | 1221 | WP_001251634.1 | fosmidomycin MFS transporter | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11809.44 Da Isoelectric Point: 10.3980
>T283321 WP_000057523.1 NZ_CP126948:c3592304-3592002 [Escherichia coli O78:H4]
MAQKKNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHRDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
MAQKKNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHRDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
Download Length: 303 bp
Antitoxin
Download Length: 114 a.a. Molecular weight: 13171.10 Da Isoelectric Point: 5.7790
>AT283321 WP_000806442.1 NZ_CP126948:c3591966-3591625 [Escherichia coli O78:H4]
MKQATRKPTTPGDILLYEYLEPLDLKINELAELLHVHRNSVSALINNNRKLTTEMAFRLAKVFDTTVDFWLNLQAAVDLW
EVENNMRTQEELGRIETVAEYLARREERAKKVA
MKQATRKPTTPGDILLYEYLEPLDLKINELAELLHVHRNSVSALINNNRKLTTEMAFRLAKVFDTTVDFWLNLQAAVDLW
EVENNMRTQEELGRIETVAEYLARREERAKKVA
Download Length: 342 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|