Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 1924504..1925335 Replicon chromosome
Accession NZ_CP126948
Organism Escherichia coli O78:H4 strain APEC E14033

Toxin (Protein)


Gene name yeeV Uniprot ID S1P968
Locus tag QQA23_RS09200 Protein ID WP_000854814.1
Coordinates 1924504..1924878 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A2G4AEU4
Locus tag QQA23_RS09205 Protein ID WP_001285591.1
Coordinates 1924967..1925335 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QQA23_RS09160 (1920539) 1920539..1921057 - 519 WP_000115885.1 ClbS/DfsB family four-helix bundle protein -
QQA23_RS09165 (1921185) 1921185..1921658 + 474 WP_024222062.1 DNA gyrase inhibitor SbmC -
QQA23_RS09170 (1921856) 1921856..1922914 + 1059 WP_001200891.1 FUSC family protein -
QQA23_RS09175 (1923086) 1923086..1923415 + 330 WP_000450409.1 DUF496 family protein -
QQA23_RS09180 (1923516) 1923516..1923650 - 135 WP_001297944.1 EutP/PduV family microcompartment system protein -
QQA23_RS09185 (1923770) 1923770..1923898 + 129 Protein_1797 transposase domain-containing protein -
QQA23_RS09190 (1924187) 1924187..1924267 - 81 Protein_1798 hypothetical protein -
QQA23_RS09195 (1924313) 1924313..1924507 - 195 WP_039023483.1 DUF5983 family protein -
QQA23_RS09200 (1924504) 1924504..1924878 - 375 WP_000854814.1 type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA Toxin
QQA23_RS09205 (1924967) 1924967..1925335 - 369 WP_001285591.1 type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA Antitoxin
QQA23_RS09210 (1925409) 1925409..1925630 - 222 WP_000692323.1 DUF987 domain-containing protein -
QQA23_RS09215 (1925693) 1925693..1926169 - 477 WP_001186726.1 RadC family protein -
QQA23_RS09220 (1926185) 1926185..1926664 - 480 WP_000860087.1 antirestriction protein -
QQA23_RS09225 (1926746) 1926746..1927564 - 819 WP_001234629.1 DUF932 domain-containing protein -
QQA23_RS09230 (1927664) 1927664..1927897 - 234 WP_001119729.1 DUF905 family protein -
QQA23_RS09235 (1927955) 1927955..1928632 + 678 WP_001339397.1 IS66-like element accessory protein TnpA -
QQA23_RS09240 (1928632) 1928632..1928979 + 348 WP_000624622.1 IS66 family insertion sequence element accessory protein TnpB -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
flank IS/Tn - - 1919300..1920520 1220


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13898.94 Da        Isoelectric Point: 7.8522

>T283312 WP_000854814.1 NZ_CP126948:c1924878-1924504 [Escherichia coli O78:H4]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13650.54 Da        Isoelectric Point: 6.6249

>AT283312 WP_001285591.1 NZ_CP126948:c1925335-1924967 [Escherichia coli O78:H4]
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTITLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829FY50

Antitoxin

Source ID Structure
AlphaFold DB A0A2G4AEU4

References