Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 186489..186711 Replicon chromosome
Accession NZ_CP126948
Organism Escherichia coli O78:H4 strain APEC E14033

Toxin (Protein)


Gene name ldrD Uniprot ID S1NWX0
Locus tag QQA23_RS00890 Protein ID WP_001295224.1
Coordinates 186604..186711 (+) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 186489..186547 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QQA23_RS00865 182374..183378 + 1005 WP_000107036.1 dipeptide ABC transporter ATP-binding subunit DppF -
QQA23_RS00870 183408..184679 - 1272 WP_001318103.1 aromatic amino acid transport family protein -
QQA23_RS00875 185155..185262 + 108 WP_000170738.1 type I toxin-antitoxin system toxin Ldr family protein -
QQA23_RS00880 185638..185745 + 108 WP_001295224.1 type I toxin-antitoxin system toxin Ldr family protein -
QQA23_RS00885 186121..186228 + 108 WP_001295224.1 type I toxin-antitoxin system toxin Ldr family protein -
- 186489..186547 - 59 - - Antitoxin
QQA23_RS00890 186604..186711 + 108 WP_001295224.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
QQA23_RS00895 186798..188477 - 1680 WP_001562264.1 cellulose biosynthesis protein BcsG -
QQA23_RS00900 188474..188665 - 192 WP_000988308.1 cellulose biosynthesis protein BcsF -
QQA23_RS00905 188662..190233 - 1572 WP_001204944.1 cellulose biosynthesis c-di-GMP-binding protein BcsE -
QQA23_RS00910 190506..190694 + 189 WP_001063315.1 cellulose biosynthesis protein BcsR -
QQA23_RS00915 190706..191458 + 753 WP_000279544.1 cellulose biosynthesis protein BcsQ -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3882.70 Da        Isoelectric Point: 9.0157

>T283304 WP_001295224.1 NZ_CP126948:186604-186711 [Escherichia coli O78:H4]
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK

Download         Length: 108 bp

Antitoxin


Download         Length: 59 bp

>AT283304 NZ_CP126948:c186547-186489 [Escherichia coli O78:H4]
TCAAGAATGGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A4P7TSJ7

Antitoxin

Download structure file

References