Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
Location | 186006..186228 | Replicon | chromosome |
Accession | NZ_CP126948 | ||
Organism | Escherichia coli O78:H4 strain APEC E14033 |
Toxin (Protein)
Gene name | ldrD | Uniprot ID | S1NWX0 |
Locus tag | QQA23_RS00885 | Protein ID | WP_001295224.1 |
Coordinates | 186121..186228 (+) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | rdlD | ||
Locus tag | - | ||
Coordinates | 186006..186072 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QQA23_RS00860 | 181394..182377 | + | 984 | WP_001196486.1 | dipeptide ABC transporter ATP-binding protein | - |
QQA23_RS00865 | 182374..183378 | + | 1005 | WP_000107036.1 | dipeptide ABC transporter ATP-binding subunit DppF | - |
QQA23_RS00870 | 183408..184679 | - | 1272 | WP_001318103.1 | aromatic amino acid transport family protein | - |
QQA23_RS00875 | 185155..185262 | + | 108 | WP_000170738.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
QQA23_RS00880 | 185638..185745 | + | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
- | 186006..186072 | - | 67 | - | - | Antitoxin |
QQA23_RS00885 | 186121..186228 | + | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
QQA23_RS00890 | 186604..186711 | + | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
QQA23_RS00895 | 186798..188477 | - | 1680 | WP_001562264.1 | cellulose biosynthesis protein BcsG | - |
QQA23_RS00900 | 188474..188665 | - | 192 | WP_000988308.1 | cellulose biosynthesis protein BcsF | - |
QQA23_RS00905 | 188662..190233 | - | 1572 | WP_001204944.1 | cellulose biosynthesis c-di-GMP-binding protein BcsE | - |
QQA23_RS00910 | 190506..190694 | + | 189 | WP_001063315.1 | cellulose biosynthesis protein BcsR | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3882.70 Da Isoelectric Point: 9.0157
>T283303 WP_001295224.1 NZ_CP126948:186121-186228 [Escherichia coli O78:H4]
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
Download Length: 108 bp
Antitoxin
Download Length: 67 bp
>AT283303 NZ_CP126948:c186072-186006 [Escherichia coli O78:H4]
GTCTAGATGCAAGAATGGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
GTCTAGATGCAAGAATGGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|