Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 79712..79976 | Replicon | plasmid pESBL-EA11 |
Accession | NC_018659 | ||
Organism | Escherichia coli O104:H4 str. 2011C-3493 |
Toxin (Protein)
Gene name | pndA | Uniprot ID | U9Z417 |
Locus tag | O3K_RS26055 | Protein ID | WP_001387489.1 |
Coordinates | 79824..79976 (+) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | pndB | ||
Locus tag | - | ||
Coordinates | 79712..79774 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
O3K_RS26040 | 75814..76884 | - | 1071 | WP_000151588.1 | IncI1-type conjugal transfer protein TrbB | - |
O3K_RS26045 | 76903..78111 | - | 1209 | WP_000121263.1 | IncI1-type conjugal transfer protein TrbA | - |
O3K_RS26050 | 78418..79509 | - | 1092 | WP_000426061.1 | hypothetical protein | - |
- | 79712..79774 | - | 63 | NuclAT_0 | - | Antitoxin |
- | 79712..79774 | - | 63 | NuclAT_0 | - | Antitoxin |
- | 79712..79774 | - | 63 | NuclAT_0 | - | Antitoxin |
- | 79712..79774 | - | 63 | NuclAT_0 | - | Antitoxin |
O3K_RS26055 | 79824..79976 | + | 153 | WP_001387489.1 | Hok/Gef family protein | Toxin |
O3K_RS26060 | 80048..80299 | - | 252 | WP_001291964.1 | hypothetical protein | - |
O3K_RS26065 | 80599..80895 | + | 297 | WP_001275298.1 | hypothetical protein | - |
O3K_RS26625 | 80960..81136 | - | 177 | WP_001054898.1 | hypothetical protein | - |
O3K_RS26070 | 81319..81528 | - | 210 | WP_001140543.1 | hemolysin expression modulator Hha | - |
O3K_RS26075 | 81626..82240 | - | 615 | WP_000578648.1 | plasmid IncI1-type surface exclusion protein ExcA | - |
O3K_RS26080 | 82316..84484 | - | 2169 | WP_000698360.1 | IncI1-type conjugal transfer membrane protein TraY | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | blaCTX-M-15 / blaTEM-1B | - | 1..88544 | 88544 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5761.10 Da Isoelectric Point: 8.7948
>T28330 WP_001387489.1 NC_018659:79824-79976 [Escherichia coli O104:H4 str. 2011C-3493]
MPQRTFLMMLIVVCVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
MPQRTFLMMLIVVCVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
Download Length: 153 bp
>T28330 NC_018659:79824-79976 [Escherichia coli O104:H4 str. 2011C-3493]
ATGCCACAGCGAACGTTTTTAATGATGTTAATCGTCGTCTGTGTGACGATTCTGTGTTTTGTCTGGATGGTGAGGGATTC
GCTTTGCGGACTCCGGCTCCAGCAGGGAAACACAGTGCTTGTGGCAACGTTAGCCTACGAAGTTAAACGTTAA
ATGCCACAGCGAACGTTTTTAATGATGTTAATCGTCGTCTGTGTGACGATTCTGTGTTTTGTCTGGATGGTGAGGGATTC
GCTTTGCGGACTCCGGCTCCAGCAGGGAAACACAGTGCTTGTGGCAACGTTAGCCTACGAAGTTAAACGTTAA
Antitoxin
Download Length: 63 bp
>AT28330 NC_018659:c79774-79712 [Escherichia coli O104:H4 str. 2011C-3493]
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|