Detailed information of TA system TA283299

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 153473..153894
• Replicon: plasmid pEND_Eco 18005
• Accession: NZ_CP126947
• Organism: Escherichia coli O78:H51 strain APEC E18005

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: QQA24_RS25705
• Protein ID: WP_231822392.1
• Coordinates: 153473..153598 (-)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	srnC
Locus tag	-
Coordinates	153696..153894 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
QQA24_RS25665 (148552)	148552..148767	-	216	WP_001352842.1	conjugal transfer relaxosome protein TraY	-
QQA24_RS25670 (148903)	148903..149550	-	648	WP_015387377.1	conjugal transfer transcriptional regulator TraJ	-
QQA24_RS25675 (149741)	149741..150124	-	384	WP_001063020.1	conjugal transfer relaxosome DNA-binding protein TraM	-
QQA24_RS25680 (150464)	150464..151066	+	603	WP_000243701.1	transglycosylase SLT domain-containing protein	-
QQA24_RS25685 (151362)	151362..152183	-	822	WP_039023648.1	DUF932 domain-containing protein	-
QQA24_RS25690 (152302)	152302..152589	-	288	WP_000107542.1	hypothetical protein	-
QQA24_RS25695 (152614)	152614..152820	-	207	WP_052908621.1	hypothetical protein	-
QQA24_RS25700 (152890)	152890..153172	+	283	Protein_160	hypothetical protein	-
QQA24_RS25705 (153473)	153473..153598	-	126	WP_231822392.1	type I toxin-antitoxin system Hok family toxin	Toxin
QQA24_RS25710 (153540)	153540..153689	-	150	Protein_162	DUF5431 family protein	-
- (153696)	153696..153894	-	199	NuclAT_0	-	Antitoxin
- (153696)	153696..153894	-	199	NuclAT_0	-	Antitoxin
- (153696)	153696..153894	-	199	NuclAT_0	-	Antitoxin
- (153696)	153696..153894	-	199	NuclAT_0	-	Antitoxin
QQA24_RS25715 (153863)	153863..154625	-	763	Protein_163	plasmid SOS inhibition protein A	-
QQA24_RS25720 (154665)	154665..154790	-	126	WP_289266498.1	chromosome partitioning protein ParB	-
QQA24_RS25725 (154957)	154957..155493	+	537	WP_000979712.1	hypothetical protein	-
QQA24_RS25730 (155690)	155690..155863	+	174	WP_000654815.1	hypothetical protein	-
QQA24_RS25735 (155911)	155911..156192	-	282	WP_001093917.1	pyocin activator PrtN family protein	-
QQA24_RS25740 (156229)	156229..156801	-	573	WP_001061348.1	3'-5' exonuclease	-
QQA24_RS25745 (156801)	156801..157031	-	231	Protein_169	DUF551 domain-containing protein	-
QQA24_RS25750 (157086)	157086..157721	-	636	Protein_170	DUF551 domain-containing protein	-
QQA24_RS25755 (157732)	157732..157995	-	264	WP_000224227.1	hypothetical protein	-
QQA24_RS25760 (158177)	158177..158368	-	192	Protein_172	ead/Ea22-like family protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	sitABCD / blaCTX-M-1	iutA / iucD / iucC / iucB / iucA / iroB / iroC / iroD / iroE / iroN / vat	1..204838	204838

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4836.75 Da
• Isoelectric Point: 7.7833

>T283299 WP_231822392.1 NZ_CP126947:c153598-153473 [Escherichia coli O78:H51]
VLIVCLTLLIFTYLTRKSLCEIRYRDGYWEVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 199 bp

>AT283299 NZ_CP126947:c153894-153696 [Escherichia coli O78:H51]
TCACACAGATTACCCGTAAACAGCCTGAATGAGCGGGTTATTTTCAGGAAAAGTGAGTGTGGTCAGCGTGCAGGGATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAGGA
CAAAAGCCCCGTAGTTAATTTTTCATTAACCCACGAGGC

Structures

Antitoxin