Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 112268..112534 | Replicon | plasmid pEND_Eco 18005 |
| Accession | NZ_CP126947 | ||
| Organism | Escherichia coli O78:H51 strain APEC E18005 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | - |
| Locus tag | QQA24_RS25460 | Protein ID | WP_289257137.1 |
| Coordinates | 112268..112429 (-) | Length | 54 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 112473..112534 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QQA24_RS25420 (108108) | 108108..108455 | - | 348 | WP_000624622.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| QQA24_RS25425 (108455) | 108455..109132 | - | 678 | WP_001339397.1 | IS66-like element accessory protein TnpA | - |
| QQA24_RS25430 (109185) | 109185..109652 | - | 468 | Protein_106 | plasmid replication initiator RepA | - |
| QQA24_RS25435 (109645) | 109645..110127 | - | 483 | WP_001273588.1 | hypothetical protein | - |
| QQA24_RS25440 (110120) | 110120..110167 | - | 48 | WP_229471593.1 | hypothetical protein | - |
| QQA24_RS25445 (110158) | 110158..110409 | + | 252 | WP_223195197.1 | replication protein RepA | - |
| QQA24_RS25450 (110426) | 110426..110683 | - | 258 | WP_000083845.1 | replication regulatory protein RepA | - |
| QQA24_RS25455 (111052) | 111052..112265 | + | 1214 | WP_289257138.1 | IS3 family transposase | - |
| QQA24_RS25460 (112268) | 112268..112429 | - | 162 | WP_289257137.1 | Hok/Gef family protein | Toxin |
| - (112473) | 112473..112534 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (112473) | 112473..112534 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (112473) | 112473..112534 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (112473) | 112473..112534 | + | 62 | NuclAT_1 | - | Antitoxin |
| QQA24_RS25465 (112790) | 112790..112864 | - | 75 | Protein_113 | endonuclease | - |
| QQA24_RS25470 (113110) | 113110..113322 | - | 213 | WP_001299730.1 | ANR family transcriptional regulator | - |
| QQA24_RS25475 (113458) | 113458..114018 | - | 561 | WP_000139315.1 | fertility inhibition protein FinO | - |
| QQA24_RS25480 (114121) | 114121..114981 | - | 861 | WP_000704513.1 | alpha/beta hydrolase | - |
| QQA24_RS25485 (115039) | 115039..115785 | - | 747 | WP_000205749.1 | conjugal transfer pilus acetylase TraX | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | sitABCD / blaCTX-M-1 | iutA / iucD / iucC / iucB / iucA / iroB / iroC / iroD / iroE / iroN / vat | 1..204838 | 204838 | |
| - | inside | IScluster/Tn | - | - | 103109..112265 | 9156 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 54 a.a. Molecular weight: 6140.38 Da Isoelectric Point: 8.7726
>T283297 WP_289257137.1 NZ_CP126947:c112429-112268 [Escherichia coli O78:H51]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVEPPRVSWRVFYL
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVEPPRVSWRVFYL
Download Length: 162 bp
Antitoxin
Download Length: 62 bp
>AT283297 NZ_CP126947:112473-112534 [Escherichia coli O78:H51]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
