Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 4907150..4907752 | Replicon | chromosome |
Accession | NZ_CP126946 | ||
Organism | Escherichia coli O78:H51 strain APEC E18005 |
Toxin (Protein)
Gene name | higB | Uniprot ID | U9XIS6 |
Locus tag | QQA24_RS23825 | Protein ID | WP_000897305.1 |
Coordinates | 4907150..4907461 (+) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | QQA24_RS23830 | Protein ID | WP_000356397.1 |
Coordinates | 4907462..4907752 (+) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QQA24_RS23795 (4902180) | 4902180..4902965 | + | 786 | WP_000059678.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
QQA24_RS23800 (4903064) | 4903064..4903663 | + | 600 | WP_001295269.1 | glucose-1-phosphatase | - |
QQA24_RS23805 (4903657) | 4903657..4904529 | + | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
QQA24_RS23810 (4904526) | 4904526..4904963 | + | 438 | WP_000560983.1 | D-aminoacyl-tRNA deacylase | - |
QQA24_RS23815 (4905008) | 4905008..4905949 | + | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
QQA24_RS23820 (4906013) | 4906013..4906921 | - | 909 | WP_001162704.1 | alpha/beta hydrolase | - |
QQA24_RS23825 (4907150) | 4907150..4907461 | + | 312 | WP_000897305.1 | hypothetical protein | Toxin |
QQA24_RS23830 (4907462) | 4907462..4907752 | + | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
QQA24_RS23835 (4908357) | 4908357..4908575 | + | 219 | WP_001315930.1 | CopG family transcriptional regulator | - |
QQA24_RS23840 (4908795) | 4908795..4909037 | + | 243 | WP_001087409.1 | protein YiiF | - |
QQA24_RS23845 (4909367) | 4909367..4910296 | - | 930 | WP_000027708.1 | formate dehydrogenase accessory protein FdhE | - |
QQA24_RS23850 (4910293) | 4910293..4910928 | - | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
QQA24_RS23855 (4910925) | 4910925..4911827 | - | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12190.19 Da Isoelectric Point: 9.7791
>T283292 WP_000897305.1 NZ_CP126946:4907150-4907461 [Escherichia coli O78:H51]
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|