Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
| Location | 4036761..4037560 | Replicon | chromosome |
| Accession | NZ_CP126946 | ||
| Organism | Escherichia coli O78:H51 strain APEC E18005 | ||
Toxin (Protein)
| Gene name | yhaV | Uniprot ID | F4VJD3 |
| Locus tag | QQA24_RS19625 | Protein ID | WP_000347266.1 |
| Coordinates | 4037096..4037560 (+) | Length | 155 a.a. |
Antitoxin (Protein)
| Gene name | prlF | Uniprot ID | S1EB98 |
| Locus tag | QQA24_RS19620 | Protein ID | WP_001307405.1 |
| Coordinates | 4036761..4037096 (+) | Length | 112 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QQA24_RS19605 (4032546) | 4032546..4033316 | - | 771 | WP_001058227.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
| QQA24_RS19610 (4033332) | 4033332..4034666 | - | 1335 | WP_000599636.1 | galactarate/glucarate/glycerate transporter GarP | - |
| QQA24_RS19615 (4035041) | 4035041..4036612 | + | 1572 | WP_001273741.1 | galactarate dehydratase | - |
| QQA24_RS19620 (4036761) | 4036761..4037096 | + | 336 | WP_001307405.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
| QQA24_RS19625 (4037096) | 4037096..4037560 | + | 465 | WP_000347266.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
| QQA24_RS19630 (4037615) | 4037615..4038424 | - | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
| QQA24_RS19635 (4038673) | 4038673..4039953 | + | 1281 | WP_000681921.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
| QQA24_RS19640 (4039976) | 4039976..4040449 | + | 474 | WP_001295547.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
| QQA24_RS19645 (4040460) | 4040460..4041239 | + | 780 | WP_000406214.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
| QQA24_RS19650 (4041229) | 4041229..4042107 | + | 879 | WP_001315856.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
| QQA24_RS19655 (4042125) | 4042125..4042559 | + | 435 | WP_000948824.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 4025773..4037560 | 11787 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17841.18 Da Isoelectric Point: 9.4947
>T283288 WP_000347266.1 NZ_CP126946:4037096-4037560 [Escherichia coli O78:H51]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRFFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRFFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A836NGD2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E0XVC7 |