Detailed information of TA system    

insolicoBioinformatically predicted

Overview


TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 1835779..1835999 Replicon chromosome
Accession NZ_CP126946
Organism Escherichia coli O78:H51 strain APEC E18005

Toxin (Protein)


Gene name ldrD Uniprot ID A0A8S7XT81
Locus tag QQA24_RS08950 Protein ID WP_074147554.1
Coordinates 1835779..1835886 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 1835933..1835999 (+)

Genomic Context


Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QQA24_RS08920 1831634..1832467 + 834 WP_000456571.1 peptide chain release factor N(5)-glutamine methyltransferase -
QQA24_RS08925 1832464..1832856 + 393 WP_000200378.1 invasion regulator SirB2 -
QQA24_RS08930 1832860..1833669 + 810 WP_001257044.1 invasion regulator SirB1 -
QQA24_RS08935 1833705..1834559 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
QQA24_RS08940 1834708..1834815 - 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein -
- 1834863..1834929 + 67 NuclAT_43 - -
- 1834863..1834929 + 67 NuclAT_43 - -
- 1834863..1834929 + 67 NuclAT_43 - -
- 1834863..1834929 + 67 NuclAT_43 - -
- 1834863..1834929 + 67 NuclAT_46 - -
- 1834863..1834929 + 67 NuclAT_46 - -
- 1834863..1834929 + 67 NuclAT_46 - -
- 1834863..1834929 + 67 NuclAT_46 - -
- 1834863..1834929 + 67 NuclAT_49 - -
- 1834863..1834929 + 67 NuclAT_49 - -
- 1834863..1834929 + 67 NuclAT_49 - -
- 1834863..1834929 + 67 NuclAT_49 - -
- 1834865..1834928 + 64 NuclAT_15 - -
- 1834865..1834928 + 64 NuclAT_15 - -
- 1834865..1834928 + 64 NuclAT_15 - -
- 1834865..1834928 + 64 NuclAT_15 - -
- 1834865..1834928 + 64 NuclAT_18 - -
- 1834865..1834928 + 64 NuclAT_18 - -
- 1834865..1834928 + 64 NuclAT_18 - -
- 1834865..1834928 + 64 NuclAT_18 - -
- 1834865..1834928 + 64 NuclAT_21 - -
- 1834865..1834928 + 64 NuclAT_21 - -
- 1834865..1834928 + 64 NuclAT_21 - -
- 1834865..1834928 + 64 NuclAT_21 - -
- 1834865..1834928 + 64 NuclAT_24 - -
- 1834865..1834928 + 64 NuclAT_24 - -
- 1834865..1834928 + 64 NuclAT_24 - -
- 1834865..1834928 + 64 NuclAT_24 - -
- 1834865..1834928 + 64 NuclAT_27 - -
- 1834865..1834928 + 64 NuclAT_27 - -
- 1834865..1834928 + 64 NuclAT_27 - -
- 1834865..1834928 + 64 NuclAT_27 - -
- 1834865..1834928 + 64 NuclAT_30 - -
- 1834865..1834928 + 64 NuclAT_30 - -
- 1834865..1834928 + 64 NuclAT_30 - -
- 1834865..1834928 + 64 NuclAT_30 - -
QQA24_RS08945 1835243..1835350 - 108 WP_000170926.1 type I toxin-antitoxin system toxin Ldr family protein -
- 1835403..1835464 + 62 NuclAT_14 - -
- 1835403..1835464 + 62 NuclAT_14 - -
- 1835403..1835464 + 62 NuclAT_14 - -
- 1835403..1835464 + 62 NuclAT_14 - -
- 1835403..1835464 + 62 NuclAT_17 - -
- 1835403..1835464 + 62 NuclAT_17 - -
- 1835403..1835464 + 62 NuclAT_17 - -
- 1835403..1835464 + 62 NuclAT_17 - -
- 1835403..1835464 + 62 NuclAT_20 - -
- 1835403..1835464 + 62 NuclAT_20 - -
- 1835403..1835464 + 62 NuclAT_20 - -
- 1835403..1835464 + 62 NuclAT_20 - -
- 1835403..1835464 + 62 NuclAT_23 - -
- 1835403..1835464 + 62 NuclAT_23 - -
- 1835403..1835464 + 62 NuclAT_23 - -
- 1835403..1835464 + 62 NuclAT_23 - -
- 1835403..1835464 + 62 NuclAT_26 - -
- 1835403..1835464 + 62 NuclAT_26 - -
- 1835403..1835464 + 62 NuclAT_26 - -
- 1835403..1835464 + 62 NuclAT_26 - -
- 1835403..1835464 + 62 NuclAT_29 - -
- 1835403..1835464 + 62 NuclAT_29 - -
- 1835403..1835464 + 62 NuclAT_29 - -
- 1835403..1835464 + 62 NuclAT_29 - -
- 1835403..1835465 + 63 NuclAT_44 - -
- 1835403..1835465 + 63 NuclAT_44 - -
- 1835403..1835465 + 63 NuclAT_44 - -
- 1835403..1835465 + 63 NuclAT_44 - -
- 1835403..1835465 + 63 NuclAT_47 - -
- 1835403..1835465 + 63 NuclAT_47 - -
- 1835403..1835465 + 63 NuclAT_47 - -
- 1835403..1835465 + 63 NuclAT_47 - -
- 1835403..1835465 + 63 NuclAT_50 - -
- 1835403..1835465 + 63 NuclAT_50 - -
- 1835403..1835465 + 63 NuclAT_50 - -
- 1835403..1835465 + 63 NuclAT_50 - -
- 1835403..1835466 + 64 NuclAT_32 - -
- 1835403..1835466 + 64 NuclAT_32 - -
- 1835403..1835466 + 64 NuclAT_32 - -
- 1835403..1835466 + 64 NuclAT_32 - -
- 1835403..1835466 + 64 NuclAT_34 - -
- 1835403..1835466 + 64 NuclAT_34 - -
- 1835403..1835466 + 64 NuclAT_34 - -
- 1835403..1835466 + 64 NuclAT_34 - -
- 1835403..1835466 + 64 NuclAT_36 - -
- 1835403..1835466 + 64 NuclAT_36 - -
- 1835403..1835466 + 64 NuclAT_36 - -
- 1835403..1835466 + 64 NuclAT_36 - -
- 1835403..1835466 + 64 NuclAT_38 - -
- 1835403..1835466 + 64 NuclAT_38 - -
- 1835403..1835466 + 64 NuclAT_38 - -
- 1835403..1835466 + 64 NuclAT_38 - -
- 1835403..1835466 + 64 NuclAT_40 - -
- 1835403..1835466 + 64 NuclAT_40 - -
- 1835403..1835466 + 64 NuclAT_40 - -
- 1835403..1835466 + 64 NuclAT_40 - -
- 1835403..1835466 + 64 NuclAT_42 - -
- 1835403..1835466 + 64 NuclAT_42 - -
- 1835403..1835466 + 64 NuclAT_42 - -
- 1835403..1835466 + 64 NuclAT_42 - -
QQA24_RS08950 1835779..1835886 - 108 WP_074147554.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 1835933..1835999 + 67 - - Antitoxin
QQA24_RS08955 1836291..1837391 - 1101 WP_001295620.1 sodium-potassium/proton antiporter ChaA -
QQA24_RS08960 1837661..1837891 + 231 WP_001146442.1 putative cation transport regulator ChaB -
QQA24_RS08965 1838048..1838743 + 696 WP_001297117.1 glutathione-specific gamma-glutamylcyclotransferase -
QQA24_RS08970 1838787..1839140 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -
QQA24_RS08975 1839325..1840719 + 1395 WP_039023412.1 inverse autotransporter invasin YchO -

Associated MGEs


MGE
detail
Similar
MGEs
Relative
position
MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains


Predicted by InterproScan

Toxin

(1-35)


Sequences


Toxin        


Download         Length: 36 a.a.        Molecular weight: 4031.79 Da        Isoelectric Point: 11.4779

>T283275 WP_074147554.1 NZ_CP126946:c1835886-1835779 [Escherichia coli O78:H51]
MTLAQFAMTFWHDLAAPILTGIITAAIVSWWRNRK

Download         Length: 108 bp


Antitoxin


Download         Length: 67 bp

>AT283275 NZ_CP126946:1835933-1835999 [Escherichia coli O78:H51]
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures


Toxin

Source ID Structure


Antitoxin

Download structure file

References