Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | ldrD-ohsC/Ldr(toxin) |
Location | 1835243..1835464 | Replicon | chromosome |
Accession | NZ_CP126946 | ||
Organism | Escherichia coli O78:H51 strain APEC E18005 |
Toxin (Protein)
Gene name | ldrD | Uniprot ID | E0IV43 |
Locus tag | QQA24_RS08945 | Protein ID | WP_000170926.1 |
Coordinates | 1835243..1835350 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | ohsC | ||
Locus tag | - | ||
Coordinates | 1835403..1835464 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QQA24_RS08915 (1830552) | 1830552..1831634 | + | 1083 | WP_000804726.1 | peptide chain release factor 1 | - |
QQA24_RS08920 (1831634) | 1831634..1832467 | + | 834 | WP_000456571.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
QQA24_RS08925 (1832464) | 1832464..1832856 | + | 393 | WP_000200378.1 | invasion regulator SirB2 | - |
QQA24_RS08930 (1832860) | 1832860..1833669 | + | 810 | WP_001257044.1 | invasion regulator SirB1 | - |
QQA24_RS08935 (1833705) | 1833705..1834559 | + | 855 | WP_000811065.1 | 3-deoxy-8-phosphooctulonate synthase | - |
QQA24_RS08940 (1834708) | 1834708..1834815 | - | 108 | WP_000170954.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
- (1834865) | 1834865..1834928 | + | 64 | NuclAT_15 | - | - |
- (1834865) | 1834865..1834928 | + | 64 | NuclAT_15 | - | - |
- (1834865) | 1834865..1834928 | + | 64 | NuclAT_15 | - | - |
- (1834865) | 1834865..1834928 | + | 64 | NuclAT_15 | - | - |
- (1834865) | 1834865..1834928 | + | 64 | NuclAT_18 | - | - |
- (1834865) | 1834865..1834928 | + | 64 | NuclAT_18 | - | - |
- (1834865) | 1834865..1834928 | + | 64 | NuclAT_18 | - | - |
- (1834865) | 1834865..1834928 | + | 64 | NuclAT_18 | - | - |
- (1834865) | 1834865..1834928 | + | 64 | NuclAT_21 | - | - |
- (1834865) | 1834865..1834928 | + | 64 | NuclAT_21 | - | - |
- (1834865) | 1834865..1834928 | + | 64 | NuclAT_21 | - | - |
- (1834865) | 1834865..1834928 | + | 64 | NuclAT_21 | - | - |
- (1834865) | 1834865..1834928 | + | 64 | NuclAT_24 | - | - |
- (1834865) | 1834865..1834928 | + | 64 | NuclAT_24 | - | - |
- (1834865) | 1834865..1834928 | + | 64 | NuclAT_24 | - | - |
- (1834865) | 1834865..1834928 | + | 64 | NuclAT_24 | - | - |
- (1834865) | 1834865..1834928 | + | 64 | NuclAT_27 | - | - |
- (1834865) | 1834865..1834928 | + | 64 | NuclAT_27 | - | - |
- (1834865) | 1834865..1834928 | + | 64 | NuclAT_27 | - | - |
- (1834865) | 1834865..1834928 | + | 64 | NuclAT_27 | - | - |
- (1834865) | 1834865..1834928 | + | 64 | NuclAT_30 | - | - |
- (1834865) | 1834865..1834928 | + | 64 | NuclAT_30 | - | - |
- (1834865) | 1834865..1834928 | + | 64 | NuclAT_30 | - | - |
- (1834865) | 1834865..1834928 | + | 64 | NuclAT_30 | - | - |
- (1834863) | 1834863..1834929 | + | 67 | NuclAT_43 | - | - |
- (1834863) | 1834863..1834929 | + | 67 | NuclAT_43 | - | - |
- (1834863) | 1834863..1834929 | + | 67 | NuclAT_43 | - | - |
- (1834863) | 1834863..1834929 | + | 67 | NuclAT_43 | - | - |
- (1834863) | 1834863..1834929 | + | 67 | NuclAT_46 | - | - |
- (1834863) | 1834863..1834929 | + | 67 | NuclAT_46 | - | - |
- (1834863) | 1834863..1834929 | + | 67 | NuclAT_46 | - | - |
- (1834863) | 1834863..1834929 | + | 67 | NuclAT_46 | - | - |
- (1834863) | 1834863..1834929 | + | 67 | NuclAT_49 | - | - |
- (1834863) | 1834863..1834929 | + | 67 | NuclAT_49 | - | - |
- (1834863) | 1834863..1834929 | + | 67 | NuclAT_49 | - | - |
- (1834863) | 1834863..1834929 | + | 67 | NuclAT_49 | - | - |
QQA24_RS08945 (1835243) | 1835243..1835350 | - | 108 | WP_000170926.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
- (1835403) | 1835403..1835464 | + | 62 | NuclAT_14 | - | Antitoxin |
- (1835403) | 1835403..1835464 | + | 62 | NuclAT_14 | - | Antitoxin |
- (1835403) | 1835403..1835464 | + | 62 | NuclAT_14 | - | Antitoxin |
- (1835403) | 1835403..1835464 | + | 62 | NuclAT_14 | - | Antitoxin |
- (1835403) | 1835403..1835464 | + | 62 | NuclAT_17 | - | Antitoxin |
- (1835403) | 1835403..1835464 | + | 62 | NuclAT_17 | - | Antitoxin |
- (1835403) | 1835403..1835464 | + | 62 | NuclAT_17 | - | Antitoxin |
- (1835403) | 1835403..1835464 | + | 62 | NuclAT_17 | - | Antitoxin |
- (1835403) | 1835403..1835464 | + | 62 | NuclAT_20 | - | Antitoxin |
- (1835403) | 1835403..1835464 | + | 62 | NuclAT_20 | - | Antitoxin |
- (1835403) | 1835403..1835464 | + | 62 | NuclAT_20 | - | Antitoxin |
- (1835403) | 1835403..1835464 | + | 62 | NuclAT_20 | - | Antitoxin |
- (1835403) | 1835403..1835464 | + | 62 | NuclAT_23 | - | Antitoxin |
- (1835403) | 1835403..1835464 | + | 62 | NuclAT_23 | - | Antitoxin |
- (1835403) | 1835403..1835464 | + | 62 | NuclAT_23 | - | Antitoxin |
- (1835403) | 1835403..1835464 | + | 62 | NuclAT_23 | - | Antitoxin |
- (1835403) | 1835403..1835464 | + | 62 | NuclAT_26 | - | Antitoxin |
- (1835403) | 1835403..1835464 | + | 62 | NuclAT_26 | - | Antitoxin |
- (1835403) | 1835403..1835464 | + | 62 | NuclAT_26 | - | Antitoxin |
- (1835403) | 1835403..1835464 | + | 62 | NuclAT_26 | - | Antitoxin |
- (1835403) | 1835403..1835464 | + | 62 | NuclAT_29 | - | Antitoxin |
- (1835403) | 1835403..1835464 | + | 62 | NuclAT_29 | - | Antitoxin |
- (1835403) | 1835403..1835464 | + | 62 | NuclAT_29 | - | Antitoxin |
- (1835403) | 1835403..1835464 | + | 62 | NuclAT_29 | - | Antitoxin |
- (1835403) | 1835403..1835465 | + | 63 | NuclAT_44 | - | - |
- (1835403) | 1835403..1835465 | + | 63 | NuclAT_44 | - | - |
- (1835403) | 1835403..1835465 | + | 63 | NuclAT_44 | - | - |
- (1835403) | 1835403..1835465 | + | 63 | NuclAT_44 | - | - |
- (1835403) | 1835403..1835465 | + | 63 | NuclAT_47 | - | - |
- (1835403) | 1835403..1835465 | + | 63 | NuclAT_47 | - | - |
- (1835403) | 1835403..1835465 | + | 63 | NuclAT_47 | - | - |
- (1835403) | 1835403..1835465 | + | 63 | NuclAT_47 | - | - |
- (1835403) | 1835403..1835465 | + | 63 | NuclAT_50 | - | - |
- (1835403) | 1835403..1835465 | + | 63 | NuclAT_50 | - | - |
- (1835403) | 1835403..1835465 | + | 63 | NuclAT_50 | - | - |
- (1835403) | 1835403..1835465 | + | 63 | NuclAT_50 | - | - |
- (1835403) | 1835403..1835466 | + | 64 | NuclAT_32 | - | - |
- (1835403) | 1835403..1835466 | + | 64 | NuclAT_32 | - | - |
- (1835403) | 1835403..1835466 | + | 64 | NuclAT_32 | - | - |
- (1835403) | 1835403..1835466 | + | 64 | NuclAT_32 | - | - |
- (1835403) | 1835403..1835466 | + | 64 | NuclAT_34 | - | - |
- (1835403) | 1835403..1835466 | + | 64 | NuclAT_34 | - | - |
- (1835403) | 1835403..1835466 | + | 64 | NuclAT_34 | - | - |
- (1835403) | 1835403..1835466 | + | 64 | NuclAT_34 | - | - |
- (1835403) | 1835403..1835466 | + | 64 | NuclAT_36 | - | - |
- (1835403) | 1835403..1835466 | + | 64 | NuclAT_36 | - | - |
- (1835403) | 1835403..1835466 | + | 64 | NuclAT_36 | - | - |
- (1835403) | 1835403..1835466 | + | 64 | NuclAT_36 | - | - |
- (1835403) | 1835403..1835466 | + | 64 | NuclAT_38 | - | - |
- (1835403) | 1835403..1835466 | + | 64 | NuclAT_38 | - | - |
- (1835403) | 1835403..1835466 | + | 64 | NuclAT_38 | - | - |
- (1835403) | 1835403..1835466 | + | 64 | NuclAT_38 | - | - |
- (1835403) | 1835403..1835466 | + | 64 | NuclAT_40 | - | - |
- (1835403) | 1835403..1835466 | + | 64 | NuclAT_40 | - | - |
- (1835403) | 1835403..1835466 | + | 64 | NuclAT_40 | - | - |
- (1835403) | 1835403..1835466 | + | 64 | NuclAT_40 | - | - |
- (1835403) | 1835403..1835466 | + | 64 | NuclAT_42 | - | - |
- (1835403) | 1835403..1835466 | + | 64 | NuclAT_42 | - | - |
- (1835403) | 1835403..1835466 | + | 64 | NuclAT_42 | - | - |
- (1835403) | 1835403..1835466 | + | 64 | NuclAT_42 | - | - |
QQA24_RS08950 (1835779) | 1835779..1835886 | - | 108 | WP_074147554.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
- (1835934) | 1835934..1835999 | + | 66 | NuclAT_13 | - | - |
- (1835934) | 1835934..1835999 | + | 66 | NuclAT_13 | - | - |
- (1835934) | 1835934..1835999 | + | 66 | NuclAT_13 | - | - |
- (1835934) | 1835934..1835999 | + | 66 | NuclAT_13 | - | - |
- (1835934) | 1835934..1835999 | + | 66 | NuclAT_16 | - | - |
- (1835934) | 1835934..1835999 | + | 66 | NuclAT_16 | - | - |
- (1835934) | 1835934..1835999 | + | 66 | NuclAT_16 | - | - |
- (1835934) | 1835934..1835999 | + | 66 | NuclAT_16 | - | - |
- (1835934) | 1835934..1835999 | + | 66 | NuclAT_19 | - | - |
- (1835934) | 1835934..1835999 | + | 66 | NuclAT_19 | - | - |
- (1835934) | 1835934..1835999 | + | 66 | NuclAT_19 | - | - |
- (1835934) | 1835934..1835999 | + | 66 | NuclAT_19 | - | - |
- (1835934) | 1835934..1835999 | + | 66 | NuclAT_22 | - | - |
- (1835934) | 1835934..1835999 | + | 66 | NuclAT_22 | - | - |
- (1835934) | 1835934..1835999 | + | 66 | NuclAT_22 | - | - |
- (1835934) | 1835934..1835999 | + | 66 | NuclAT_22 | - | - |
- (1835934) | 1835934..1835999 | + | 66 | NuclAT_25 | - | - |
- (1835934) | 1835934..1835999 | + | 66 | NuclAT_25 | - | - |
- (1835934) | 1835934..1835999 | + | 66 | NuclAT_25 | - | - |
- (1835934) | 1835934..1835999 | + | 66 | NuclAT_25 | - | - |
- (1835934) | 1835934..1835999 | + | 66 | NuclAT_28 | - | - |
- (1835934) | 1835934..1835999 | + | 66 | NuclAT_28 | - | - |
- (1835934) | 1835934..1835999 | + | 66 | NuclAT_28 | - | - |
- (1835934) | 1835934..1835999 | + | 66 | NuclAT_28 | - | - |
- (1835935) | 1835935..1836000 | + | 66 | NuclAT_45 | - | - |
- (1835935) | 1835935..1836000 | + | 66 | NuclAT_45 | - | - |
- (1835935) | 1835935..1836000 | + | 66 | NuclAT_45 | - | - |
- (1835935) | 1835935..1836000 | + | 66 | NuclAT_45 | - | - |
- (1835935) | 1835935..1836000 | + | 66 | NuclAT_48 | - | - |
- (1835935) | 1835935..1836000 | + | 66 | NuclAT_48 | - | - |
- (1835935) | 1835935..1836000 | + | 66 | NuclAT_48 | - | - |
- (1835935) | 1835935..1836000 | + | 66 | NuclAT_48 | - | - |
- (1835935) | 1835935..1836000 | + | 66 | NuclAT_51 | - | - |
- (1835935) | 1835935..1836000 | + | 66 | NuclAT_51 | - | - |
- (1835935) | 1835935..1836000 | + | 66 | NuclAT_51 | - | - |
- (1835935) | 1835935..1836000 | + | 66 | NuclAT_51 | - | - |
- (1835934) | 1835934..1836001 | + | 68 | NuclAT_31 | - | - |
- (1835934) | 1835934..1836001 | + | 68 | NuclAT_31 | - | - |
- (1835934) | 1835934..1836001 | + | 68 | NuclAT_31 | - | - |
- (1835934) | 1835934..1836001 | + | 68 | NuclAT_31 | - | - |
- (1835934) | 1835934..1836001 | + | 68 | NuclAT_33 | - | - |
- (1835934) | 1835934..1836001 | + | 68 | NuclAT_33 | - | - |
- (1835934) | 1835934..1836001 | + | 68 | NuclAT_33 | - | - |
- (1835934) | 1835934..1836001 | + | 68 | NuclAT_33 | - | - |
- (1835934) | 1835934..1836001 | + | 68 | NuclAT_35 | - | - |
- (1835934) | 1835934..1836001 | + | 68 | NuclAT_35 | - | - |
- (1835934) | 1835934..1836001 | + | 68 | NuclAT_35 | - | - |
- (1835934) | 1835934..1836001 | + | 68 | NuclAT_35 | - | - |
- (1835934) | 1835934..1836001 | + | 68 | NuclAT_37 | - | - |
- (1835934) | 1835934..1836001 | + | 68 | NuclAT_37 | - | - |
- (1835934) | 1835934..1836001 | + | 68 | NuclAT_37 | - | - |
- (1835934) | 1835934..1836001 | + | 68 | NuclAT_37 | - | - |
- (1835934) | 1835934..1836001 | + | 68 | NuclAT_39 | - | - |
- (1835934) | 1835934..1836001 | + | 68 | NuclAT_39 | - | - |
- (1835934) | 1835934..1836001 | + | 68 | NuclAT_39 | - | - |
- (1835934) | 1835934..1836001 | + | 68 | NuclAT_39 | - | - |
- (1835934) | 1835934..1836001 | + | 68 | NuclAT_41 | - | - |
- (1835934) | 1835934..1836001 | + | 68 | NuclAT_41 | - | - |
- (1835934) | 1835934..1836001 | + | 68 | NuclAT_41 | - | - |
- (1835934) | 1835934..1836001 | + | 68 | NuclAT_41 | - | - |
QQA24_RS08955 (1836291) | 1836291..1837391 | - | 1101 | WP_001295620.1 | sodium-potassium/proton antiporter ChaA | - |
QQA24_RS08960 (1837661) | 1837661..1837891 | + | 231 | WP_001146442.1 | putative cation transport regulator ChaB | - |
QQA24_RS08965 (1838048) | 1838048..1838743 | + | 696 | WP_001297117.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
QQA24_RS08970 (1838787) | 1838787..1839140 | - | 354 | WP_001169669.1 | DsrE/F sulfur relay family protein YchN | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3983.84 Da Isoelectric Point: 11.6501
>T283271 WP_000170926.1 NZ_CP126946:c1835350-1835243 [Escherichia coli O78:H51]
MTLAKFAMIFWHDLAAPILAGIITAAIVGWWRNRK
MTLAKFAMIFWHDLAAPILAGIITAAIVGWWRNRK
Download Length: 108 bp
Antitoxin
Download Length: 62 bp
>AT283271 NZ_CP126946:1835403-1835464 [Escherichia coli O78:H51]
TGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT
TGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|