Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | DinJ-YafQ (relBE)/YafQ-RelB |
Location | 769728..770269 | Replicon | chromosome |
Accession | NZ_CP126946 | ||
Organism | Escherichia coli O78:H51 strain APEC E18005 |
Toxin (Protein)
Gene name | yafQ | Uniprot ID | U9XPG0 |
Locus tag | QQA24_RS03695 | Protein ID | WP_000615976.1 |
Coordinates | 769728..770006 (-) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | dinJ | Uniprot ID | S1EWQ0 |
Locus tag | QQA24_RS03700 | Protein ID | WP_000729704.1 |
Coordinates | 770009..770269 (-) | Length | 87 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QQA24_RS03680 (767310) | 767310..767888 | + | 579 | WP_000284050.1 | D-sedoheptulose 7-phosphate isomerase | - |
QQA24_RS03685 (768094) | 768094..768861 | + | 768 | WP_000333380.1 | class II glutamine amidotransferase | - |
QQA24_RS03690 (768832) | 768832..769572 | - | 741 | WP_001225679.1 | peptidoglycan meso-diaminopimelic acid protein amidase | - |
QQA24_RS03695 (769728) | 769728..770006 | - | 279 | WP_000615976.1 | type II toxin-antitoxin system mRNA interferase toxin YafQ | Toxin |
QQA24_RS03700 (770009) | 770009..770269 | - | 261 | WP_000729704.1 | type II toxin-antitoxin system antitoxin DinJ | Antitoxin |
QQA24_RS03705 (770455) | 770455..771228 | + | 774 | WP_148935748.1 | C40 family peptidase | - |
QQA24_RS03710 (771285) | 771285..771641 | - | 357 | WP_001030483.1 | type II toxin-antitoxin system HicB family antitoxin | - |
QQA24_RS03715 (771634) | 771634..771912 | - | 279 | WP_000598760.1 | type II toxin-antitoxin system HicA family toxin | - |
QQA24_RS03720 (772017) | 772017..773729 | - | 1713 | Protein_730 | flagellar biosynthesis protein FlhA | - |
QQA24_RS03725 (773701) | 773701..774486 | + | 786 | WP_000207575.1 | putative lateral flagellar export/assembly protein LafU | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | gmhA/lpcA | 760779..771912 | 11133 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10800.59 Da Isoelectric Point: 10.0702
>T283268 WP_000615976.1 NZ_CP126946:c770006-769728 [Escherichia coli O78:H51]
MIQRDIEYSGQFSKDVKLAQKRHKDMNKLKYLMTLLINNALPLPAVYKDHPLQGSWKGYRDAHVEPDWILIYKLTDKLLR
FERTGTHAALFG
MIQRDIEYSGQFSKDVKLAQKRHKDMNKLKYLMTLLINNALPLPAVYKDHPLQGSWKGYRDAHVEPDWILIYKLTDKLLR
FERTGTHAALFG
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | U9XPG0 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 4ML0 | |
AlphaFold DB | A0A0E0Y6Z6 |