Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 4932618..4933220 | Replicon | chromosome |
Accession | NZ_CP126944 | ||
Organism | Escherichia coli O1:K1:H7 strain APEC E16002 |
Toxin (Protein)
Gene name | higB | Uniprot ID | S1P416 |
Locus tag | QQA28_RS24305 | Protein ID | WP_000897302.1 |
Coordinates | 4932909..4933220 (-) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | QQA28_RS24300 | Protein ID | WP_000356397.1 |
Coordinates | 4932618..4932908 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QQA28_RS24275 (4928691) | 4928691..4929593 | + | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
QQA28_RS24280 (4929590) | 4929590..4930225 | + | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
QQA28_RS24285 (4930222) | 4930222..4931151 | + | 930 | WP_000027720.1 | formate dehydrogenase accessory protein FdhE | - |
QQA28_RS24290 (4931367) | 4931367..4931585 | - | 219 | WP_001314326.1 | CopG family transcriptional regulator | - |
QQA28_RS24295 (4931981) | 4931981..4932259 | - | 279 | WP_001296612.1 | hypothetical protein | - |
QQA28_RS24300 (4932618) | 4932618..4932908 | - | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
QQA28_RS24305 (4932909) | 4932909..4933220 | - | 312 | WP_000897302.1 | hypothetical protein | Toxin |
QQA28_RS24310 (4933449) | 4933449..4934357 | + | 909 | WP_001331553.1 | alpha/beta hydrolase | - |
QQA28_RS24315 (4934421) | 4934421..4935362 | - | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
QQA28_RS24320 (4935407) | 4935407..4935844 | - | 438 | WP_000560983.1 | D-aminoacyl-tRNA deacylase | - |
QQA28_RS24325 (4935841) | 4935841..4936713 | - | 873 | WP_000920754.1 | virulence factor BrkB family protein | - |
QQA28_RS24330 (4936707) | 4936707..4937306 | - | 600 | WP_001314324.1 | glucose-1-phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12203.19 Da Isoelectric Point: 9.7791
>T283256 WP_000897302.1 NZ_CP126944:c4933220-4932909 [Escherichia coli O1:K1:H7]
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|