Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | symE-ohsC/SymE(toxin) |
| Location | 4300766..4301178 | Replicon | chromosome |
| Accession | NZ_CP126944 | ||
| Organism | Escherichia coli O1:K1:H7 strain APEC E16002 | ||
Toxin (Protein)
| Gene name | symE | Uniprot ID | - |
| Locus tag | QQA28_RS21300 | Protein ID | WP_001622590.1 |
| Coordinates | 4300837..4301178 (+) | Length | 114 a.a. |
Antitoxin (RNA)
| Gene name | ohsC | ||
| Locus tag | - | ||
| Coordinates | 4300766..4300842 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QQA28_RS21290 (4297629) | 4297629..4299218 | + | 1590 | WP_001063204.1 | type I restriction-modification system methyltransferase | - |
| QQA28_RS21295 (4299215) | 4299215..4300609 | + | 1395 | WP_001272447.1 | type I restriction-modification system specificity subunit | - |
| - (4300766) | 4300766..4300842 | - | 77 | NuclAT_5 | - | Antitoxin |
| - (4300766) | 4300766..4300842 | - | 77 | NuclAT_5 | - | Antitoxin |
| - (4300766) | 4300766..4300842 | - | 77 | NuclAT_5 | - | Antitoxin |
| - (4300766) | 4300766..4300842 | - | 77 | NuclAT_5 | - | Antitoxin |
| - (4300766) | 4300766..4300842 | - | 77 | NuclAT_6 | - | Antitoxin |
| - (4300766) | 4300766..4300842 | - | 77 | NuclAT_6 | - | Antitoxin |
| - (4300766) | 4300766..4300842 | - | 77 | NuclAT_6 | - | Antitoxin |
| - (4300766) | 4300766..4300842 | - | 77 | NuclAT_6 | - | Antitoxin |
| QQA28_RS21300 (4300837) | 4300837..4301178 | + | 342 | WP_001622590.1 | endoribonuclease SymE | Toxin |
| QQA28_RS21305 (4301340) | 4301340..4302719 | + | 1380 | WP_032147538.1 | 5-methylcytosine-specific restriction endonuclease subunit McrB | - |
| QQA28_RS21310 (4302719) | 4302719..4303765 | + | 1047 | WP_000437621.1 | 5-methylcytosine-specific restriction endonuclease system specificity protein McrC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12144.98 Da Isoelectric Point: 9.1114
>T283249 WP_001622590.1 NZ_CP126944:4300837-4301178 [Escherichia coli O1:K1:H7]
MTDTHSIAQPFEAEVSPANNRHVTVGYASRYPGYSRIPAITLKGQWLEAAGFATGTAVDVKVMEGCIVLTAQPPAAEESE
LMQSLRQVCKLSARKQKQVQAFIGVIAGKQKVA
MTDTHSIAQPFEAEVSPANNRHVTVGYASRYPGYSRIPAITLKGQWLEAAGFATGTAVDVKVMEGCIVLTAQPPAAEESE
LMQSLRQVCKLSARKQKQVQAFIGVIAGKQKVA
Download Length: 342 bp
Antitoxin
Download Length: 77 bp
>AT283249 NZ_CP126944:c4300842-4300766 [Escherichia coli O1:K1:H7]
AGTCATAACTGCTATTCTCCAGGAATAGTGATTGTGATTAGCGATGCAGGTGTGTTGGCGCACATCCGCACCGCGCT
AGTCATAACTGCTATTCTCCAGGAATAGTGATTGTGATTAGCGATGCAGGTGTGTTGGCGCACATCCGCACCGCGCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|