Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
| Location | 3905884..3906578 | Replicon | chromosome |
| Accession | NZ_CP126944 | ||
| Organism | Escherichia coli O1:K1:H7 strain APEC E16002 | ||
Toxin (Protein)
| Gene name | yafO | Uniprot ID | S1PJQ2 |
| Locus tag | QQA28_RS19385 | Protein ID | WP_001263500.1 |
| Coordinates | 3905884..3906282 (-) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | yafN | Uniprot ID | S1QAE3 |
| Locus tag | QQA28_RS19390 | Protein ID | WP_000554758.1 |
| Coordinates | 3906285..3906578 (-) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QQA28_RS19360 (3901249) | 3901249..3901707 | - | 459 | WP_001291988.1 | xanthine phosphoribosyltransferase | - |
| QQA28_RS19365 (3901968) | 3901968..3903425 | + | 1458 | WP_001292999.1 | cytosol nonspecific dipeptidase | - |
| QQA28_RS19370 (3903482) | 3903482..3904096 | - | 615 | WP_000602123.1 | peptide chain release factor H | - |
| QQA28_RS19375 (3904093) | 3904093..3905232 | - | 1140 | WP_000521577.1 | RNA ligase RtcB family protein | - |
| QQA28_RS19380 (3905422) | 3905422..3905874 | - | 453 | WP_001059895.1 | GNAT family N-acetyltransferase | - |
| QQA28_RS19385 (3905884) | 3905884..3906282 | - | 399 | WP_001263500.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
| QQA28_RS19390 (3906285) | 3906285..3906578 | - | 294 | WP_000554758.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
| QQA28_RS19395 (3906630) | 3906630..3907685 | - | 1056 | WP_001226168.1 | DNA polymerase IV | - |
| QQA28_RS19400 (3907756) | 3907756..3908541 | - | 786 | WP_000207544.1 | putative lateral flagellar export/assembly protein LafU | - |
| QQA28_RS19405 (3908513) | 3908513..3910225 | + | 1713 | Protein_3805 | flagellar biosynthesis protein FlhA | - |
| QQA28_RS19410 (3910304) | 3910304..3910462 | + | 159 | WP_014639450.1 | hypothetical protein | - |
| QQA28_RS19415 (3910545) | 3910545..3911042 | - | 498 | WP_000006241.1 | REP-associated tyrosine transposase RayT | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | gmhA/lpcA | 3905884..3926238 | 20354 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15413.85 Da Isoelectric Point: 8.9511
>T283247 WP_001263500.1 NZ_CP126944:c3906282-3905884 [Escherichia coli O1:K1:H7]
MRVFKTKLIRLQLTAEELEALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDAAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELEALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDAAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|