Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HTH_XRE |
| Location | 3664101..3664780 | Replicon | chromosome |
| Accession | NZ_CP126944 | ||
| Organism | Escherichia coli O1:K1:H7 strain APEC E16002 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | V0VBP6 |
| Locus tag | QQA28_RS18240 | Protein ID | WP_000057524.1 |
| Coordinates | 3664478..3664780 (-) | Length | 101 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | S1QAY3 |
| Locus tag | QQA28_RS18235 | Protein ID | WP_000806442.1 |
| Coordinates | 3664101..3664442 (-) | Length | 114 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QQA28_RS18225 (3660345) | 3660345..3661277 | - | 933 | WP_000883052.1 | glutaminase A | - |
| QQA28_RS18230 (3661539) | 3661539..3664043 | + | 2505 | WP_000083945.1 | copper-exporting P-type ATPase CopA | - |
| QQA28_RS18235 (3664101) | 3664101..3664442 | - | 342 | WP_000806442.1 | HigA family addiction module antitoxin | Antitoxin |
| QQA28_RS18240 (3664478) | 3664478..3664780 | - | 303 | WP_000057524.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| QQA28_RS18245 (3664913) | 3664913..3665707 | + | 795 | WP_000365177.1 | TraB/GumN family protein | - |
| QQA28_RS18250 (3665911) | 3665911..3666390 | + | 480 | WP_000186633.1 | Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase YbaK | - |
| QQA28_RS18255 (3666414) | 3666414..3667214 | + | 801 | WP_000439796.1 | hypothetical protein | - |
| QQA28_RS18260 (3667211) | 3667211..3667714 | + | 504 | WP_000667000.1 | hypothetical protein | - |
| QQA28_RS18265 (3667752) | 3667752..3669404 | - | 1653 | WP_080282699.1 | bifunctional UDP-sugar hydrolase/5'-nucleotidase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 3656790..3667714 | 10924 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11839.47 Da Isoelectric Point: 10.2237
>T283245 WP_000057524.1 NZ_CP126944:c3664780-3664478 [Escherichia coli O1:K1:H7]
MAQKKNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHWDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
MAQKKNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHWDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
Download Length: 303 bp
Antitoxin
Download Length: 114 a.a. Molecular weight: 13171.10 Da Isoelectric Point: 5.7790
>AT283245 WP_000806442.1 NZ_CP126944:c3664442-3664101 [Escherichia coli O1:K1:H7]
MKQATRKPTTPGDILLYEYLEPLDLKINELAELLHVHRNSVSALINNNRKLTTEMAFRLAKVFDTTVDFWLNLQAAVDLW
EVENNMRTQEELGRIETVAEYLARREERAKKVA
MKQATRKPTTPGDILLYEYLEPLDLKINELAELLHVHRNSVSALINNNRKLTTEMAFRLAKVFDTTVDFWLNLQAAVDLW
EVENNMRTQEELGRIETVAEYLARREERAKKVA
Download Length: 342 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|