Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 2620416..2620978 | Replicon | chromosome |
Accession | NZ_CP126944 | ||
Organism | Escherichia coli O1:K1:H7 strain APEC E16002 |
Toxin (Protein)
Gene name | higB | Uniprot ID | S1Q1V8 |
Locus tag | QQA28_RS12890 | Protein ID | WP_000605675.1 |
Coordinates | 2620416..2620694 (+) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | S1PAQ1 |
Locus tag | QQA28_RS12895 | Protein ID | WP_000781370.1 |
Coordinates | 2620694..2620978 (+) | Length | 95 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QQA28_RS12865 (2616004) | 2616004..2616435 | - | 432 | WP_000152310.1 | peroxiredoxin OsmC | - |
QQA28_RS12870 (2616780) | 2616780..2616995 | + | 216 | WP_000495766.1 | biofilm-dependent modulation protein | - |
QQA28_RS12875 (2617097) | 2617097..2617234 | + | 138 | WP_000841554.1 | stationary-phase-induced ribosome-associated protein | - |
QQA28_RS12880 (2617390) | 2617390..2619087 | + | 1698 | WP_000433462.1 | malate dehydrogenase | - |
QQA28_RS12885 (2619220) | 2619220..2620230 | + | 1011 | WP_000642412.1 | alcohol dehydrogenase AdhP | - |
QQA28_RS12890 (2620416) | 2620416..2620694 | + | 279 | WP_000605675.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QQA28_RS12895 (2620694) | 2620694..2620978 | + | 285 | WP_000781370.1 | HigA family addiction module antitoxin | Antitoxin |
QQA28_RS12900 (2621207) | 2621207..2621860 | - | 654 | WP_000045647.1 | formate dehydrogenase-N subunit gamma | - |
QQA28_RS12905 (2621853) | 2621853..2622737 | - | 885 | WP_001240584.1 | formate dehydrogenase N subunit beta | - |
QQA28_RS12910 (2622750) | 2622750..2625797 | - | 3048 | WP_011478186.1 | formate dehydrogenase-N subunit alpha | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10537.16 Da Isoelectric Point: 7.3206
>T283244 WP_000605675.1 NZ_CP126944:2620416-2620694 [Escherichia coli O1:K1:H7]
MIMNFRHKGLRDLFLLGKTSGVIPTQVKRLRHRLAVIDAACCLADIDMPGYRLHPLSGDRDGIWAISVSGNWRITFEFVN
GDAYILDYEDYH
MIMNFRHKGLRDLFLLGKTSGVIPTQVKRLRHRLAVIDAACCLADIDMPGYRLHPLSGDRDGIWAISVSGNWRITFEFVN
GDAYILDYEDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | S1Q1V8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CUG6 |