Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
| Location | 4932070..4932672 | Replicon | chromosome |
| Accession | NZ_CP126942 | ||
| Organism | Escherichia coli O1:K1:H7 strain APEC E18006 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | S1P416 |
| Locus tag | QQA29_RS24305 | Protein ID | WP_000897302.1 |
| Coordinates | 4932361..4932672 (-) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | QQA29_RS24300 | Protein ID | WP_000356397.1 |
| Coordinates | 4932070..4932360 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QQA29_RS24275 (4928143) | 4928143..4929045 | + | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
| QQA29_RS24280 (4929042) | 4929042..4929677 | + | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
| QQA29_RS24285 (4929674) | 4929674..4930603 | + | 930 | WP_000027720.1 | formate dehydrogenase accessory protein FdhE | - |
| QQA29_RS24290 (4930819) | 4930819..4931037 | - | 219 | WP_001314326.1 | CopG family transcriptional regulator | - |
| QQA29_RS24295 (4931433) | 4931433..4931711 | - | 279 | WP_001296612.1 | hypothetical protein | - |
| QQA29_RS24300 (4932070) | 4932070..4932360 | - | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
| QQA29_RS24305 (4932361) | 4932361..4932672 | - | 312 | WP_000897302.1 | hypothetical protein | Toxin |
| QQA29_RS24310 (4932901) | 4932901..4933809 | + | 909 | WP_001331553.1 | alpha/beta hydrolase | - |
| QQA29_RS24315 (4933873) | 4933873..4934814 | - | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
| QQA29_RS24320 (4934859) | 4934859..4935296 | - | 438 | WP_000560983.1 | D-aminoacyl-tRNA deacylase | - |
| QQA29_RS24325 (4935293) | 4935293..4936165 | - | 873 | WP_000920754.1 | virulence factor BrkB family protein | - |
| QQA29_RS24330 (4936159) | 4936159..4936758 | - | 600 | WP_001314324.1 | glucose-1-phosphatase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12203.19 Da Isoelectric Point: 9.7791
>T283221 WP_000897302.1 NZ_CP126942:c4932672-4932361 [Escherichia coli O1:K1:H7]
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|