Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | symE-ohsC/SymE(toxin) |
Location | 4300275..4300687 | Replicon | chromosome |
Accession | NZ_CP126942 | ||
Organism | Escherichia coli O1:K1:H7 strain APEC E18006 |
Toxin (Protein)
Gene name | symE | Uniprot ID | - |
Locus tag | QQA29_RS21295 | Protein ID | WP_001622590.1 |
Coordinates | 4300346..4300687 (+) | Length | 114 a.a. |
Antitoxin (RNA)
Gene name | ohsC | ||
Locus tag | - | ||
Coordinates | 4300275..4300351 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QQA29_RS21285 (4297138) | 4297138..4298727 | + | 1590 | WP_001063204.1 | type I restriction-modification system methyltransferase | - |
QQA29_RS21290 (4298724) | 4298724..4300118 | + | 1395 | WP_001272447.1 | type I restriction-modification system specificity subunit | - |
- (4300275) | 4300275..4300351 | - | 77 | NuclAT_5 | - | Antitoxin |
- (4300275) | 4300275..4300351 | - | 77 | NuclAT_5 | - | Antitoxin |
- (4300275) | 4300275..4300351 | - | 77 | NuclAT_5 | - | Antitoxin |
- (4300275) | 4300275..4300351 | - | 77 | NuclAT_5 | - | Antitoxin |
- (4300275) | 4300275..4300351 | - | 77 | NuclAT_6 | - | Antitoxin |
- (4300275) | 4300275..4300351 | - | 77 | NuclAT_6 | - | Antitoxin |
- (4300275) | 4300275..4300351 | - | 77 | NuclAT_6 | - | Antitoxin |
- (4300275) | 4300275..4300351 | - | 77 | NuclAT_6 | - | Antitoxin |
QQA29_RS21295 (4300346) | 4300346..4300687 | + | 342 | WP_001622590.1 | endoribonuclease SymE | Toxin |
QQA29_RS21300 (4300849) | 4300849..4302228 | + | 1380 | WP_032147538.1 | 5-methylcytosine-specific restriction endonuclease subunit McrB | - |
QQA29_RS21305 (4302228) | 4302228..4303274 | + | 1047 | WP_000437621.1 | 5-methylcytosine-specific restriction endonuclease system specificity protein McrC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12144.98 Da Isoelectric Point: 9.1114
>T283214 WP_001622590.1 NZ_CP126942:4300346-4300687 [Escherichia coli O1:K1:H7]
MTDTHSIAQPFEAEVSPANNRHVTVGYASRYPGYSRIPAITLKGQWLEAAGFATGTAVDVKVMEGCIVLTAQPPAAEESE
LMQSLRQVCKLSARKQKQVQAFIGVIAGKQKVA
MTDTHSIAQPFEAEVSPANNRHVTVGYASRYPGYSRIPAITLKGQWLEAAGFATGTAVDVKVMEGCIVLTAQPPAAEESE
LMQSLRQVCKLSARKQKQVQAFIGVIAGKQKVA
Download Length: 342 bp
Antitoxin
Download Length: 77 bp
>AT283214 NZ_CP126942:c4300351-4300275 [Escherichia coli O1:K1:H7]
AGTCATAACTGCTATTCTCCAGGAATAGTGATTGTGATTAGCGATGCAGGTGTGTTGGCGCACATCCGCACCGCGCT
AGTCATAACTGCTATTCTCCAGGAATAGTGATTGTGATTAGCGATGCAGGTGTGTTGGCGCACATCCGCACCGCGCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|